[Update] CfP: *URBAN/RURAL* in non-western cinema.

full name / name of organization: 
"Many Cinemas" - a new e-magazine for Asian, African, Latin American and other small cinema traditions
contact email: 


We have decided to create a NEW CATEGORY in our first issue and would like to invite you to have a look beyond the silver screen. Hence, the new category is named "BEYOND THE SCREEN" and shall include topics (one or two articles per issue) which are loosely connected with films, like performance, music, dance, visual culture, literature, or television. These ties should not be too vague and the article ought to be somehow connected with the cinema. Thus we expand our call due to this category.

The CfP for URBAN/RURAL in non-western cinema is still running till 1st of December and we are eagerly waiting for your proposals. Here to remember:

'Urban/Rural'

This dichotomy seems to be a classical theme for studies on Asia, Africa, or Latin America. Thus, this is the reason, why we will dedicate the first issue of "Many Cinemas" this very special topic. Tokyo, Peking, Lagos, Bombay, Rio, Mexico at the one hand and the countryside at the other. We aren't looking for articles about analyzes of any specific city or village. We are interested in articles about films, which shows the sphere in-between.

    • How can we describe the tension, when a film cross the border from countryside to a city?

    • Or, when we will see the village out of the eyes of a city dweller, who has stranded there?

    • What is so special, so fascinating about the other side?

    • Is it dangerous to be there, and what's the danger?

    • Is there any social distinction written in the cinematic pictures of urban/rural?

    • And how does the film lead us through all of this?


    "Many Cinemas" seeks for papers which enriches the discussion on film theory and aesthetics of non-western movies. We would like to invite any researcher all over the world to participate in "Many Cinemas".

    We welcome papers on the topic of urban/rural in films of Asia, Africa, and Latin America.

    Please send us first your proposal (300 to 500 words) and a short CV until 1st of December 2010. We will answer you before Christmas.

    The later articles should have a length of 3000 to 4000 words. The deadline is 31th of March 2011. We hope to publish the papers Early May 2011. For any inquiry, do not hesitate to mail us.

    Proposal deadline: 01 December 2010


    Article deadline: 31 March 2011

    Please send your proposals to Helen Staufer and Michael Christopher (manycinemas@anpa.de).

    -------

    "Many Cinemas" is a forthcoming e-magazine (1st Issue announced: Spring 2011). It will dedicate its bi-annual issues the many many cinemas of the non-western world, namely Asia, Africa, Latin America and other small cinema traditions.

    "Many Cinemas" will be a magazine for film aesthetics, theory and analysis beyond the main stream film studies. Every issue will focus one specific topic, and we hope to publish different articles from each continent. The editors will select the proposals and accompany the publishing process. Afterward, "Many Cinemas" will be open peer reviewed, respectively commented. We are planning to get an ISSN-Number and to cooperate with research institutes all over the world.

    There is still no web representation of Many Cinemas. We regret this very much. But it will come soon. You'll be informed.

    39022POLITICS, PERFORMANCE AND POPULAR CULTURE IN NINETEENTH-CENTURY BRITAINUniversities of Birmingham and Lancasterk.newey@bham.ac.uk1288701817interdisciplinarypopular_culturetheatrevictorianfull name / name of organization: Universities of Birmingham and Lancastercontact email: k.newey@bham.ac.uk

    POLITICS, PERFORMANCE AND POPULAR CULTURE IN NINETEENTH-CENTURY BRITAIN

    7-9 JULY 2011

    To be held at the Storey Institute, Lancaster.

    This is advanced notice of the second conference held under the auspices of our AHRC-sponsored project 'Cultural History of English Pantomime, 1837-1902'.

    We welcome proposals for 30 minute papers which explore the connections between politics and popular culture, 1820-1910. In particular, we are interested in examining the extent to which popular theatre can reveal public perceptions of contemporary social and political issues. And conversely, how might popular entertainment influence and shape contemporary political debate?

    Confirmed speakers include: Jim Davis (Warwick), Tracy Davis (Northwestern), Brian Maidment (Salford), David Mayer (Manchester), Rohan McWilliam (Anglia Ruskin), Kate Newey (Birmingham) and Mike Sanders (Manchester).

    Further information available here:

    http://www.drama.bham.ac.uk/conferences/19thcentury.shtml

    Deadline for proposals: 1 April 2011

    For further information, please contact: p.yeandle@lancaster.ac.uk

    Peter Yeandle

    Kate Newey

    Jeffrey Richards

    Topics and themes might include:

    · Politics as theatre/theatre as politics

    · Conceptual approaches to notions of "performance" and "popular culture"

    · Theatrical metaphor

    · Topical allusion/topical referencing

    · Gender, class and representation

    · Style/Genre/Form

    · Popular politics – eg., Chartism; Fabianism; Christian Socialism.

    · Crowd, audience, presentation

    · Children on stage/children in the audience

    · Subversion/inversion

    · Theatre reform/political reform

    · Censorship, regulation, control

    · Metropolis, periphery and region

    · Historiography of leisure and pleasure.

    cfp categories: interdisciplinarypopular_culturetheatrevictorian 39023Computers and Writing 2011 - "Writing in Motion: Traversing Public/Private Spaces" CFP due Nov 15, 2010Sweetland Center for Writing - University of Michigansweetlandcandw2011@umich.edu1288705380african-americanamericanecocriticism_and_environmental_studiesfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsgraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryinternational_conferencesmodernist studiespopular_cultureprofessional_topicsrhetoric_and_compositionscience_and_culturetheatretheorytwentieth_century_and_beyondfull name / name of organization: Sweetland Center for Writing - University of Michigancontact email: sweetlandcandw2011@umich.edu

    Writing is in motion as never before: students text one another on the go and around the clock; colleagues and friends use wikis to brainstorm and to co-author important documents; choreographers and filmmakers use motion-capture technology to "write down" movement and gesture; and poets invent new multimedia poetic forms. The places we write, and the features of the writing we value, are today more varied – and often more contested – than ever before.

    We welcome proposals in a variety of formats that interpret the conference themes from multiple perspectives. Regardless of format (see Session Types below), each proposal should provide the following:

    •250 words (up to 500 words total for panels or roundtables) or a 2-minute video or other multimedia piece describing or demonstrating in detail what will happen during the session,
    •specifics on how it will facilitate interaction and/or dialogue,
    •information about what technologies it will employ to do so,
    •and one or more keywords to tag proposals and sessions.
    In dialogue with the ongoing professional conversation about making conferences more accessible, we are asking participants to submit full versions or detailed outlines of their papers or presentations, and any peripheral materials, by Wednesday, May 11, a week in advance, so that they may be posted to the conference website. By providing a paper or an outline of talking points and a statement of the main argument, and/or written descriptions or transcripts of visual images or video, participants will make the conference more accessible to all. Some collateral benefits of this practice will be, first, to enable participants to read/view materials in advance and engage in fuller dialogue during sessions, and second, to create a living document that will allow conference conversations to continue.

    In the interest of including as many people as possible on the program, we ask that you submit a proposal for only one speaking role. Speakers should plan on making use of relevant technology, rather than simply reading papers.

    SESSION TYPES

    Conversation Starters: 5-minute individual presentations facilitate vigorous and lively dialogue among session attendees by offering (i) a discussion point, (ii) evidence for the point, and (iii) two or three questions to initiate conversation. Conversation Starters can be presented in a range of formats, e.g., orally, through image, audio, video, or a combination of these.

    New Media Poster/Installation: "Posters" display new media research and pedagogy in their natural habitat – on screen (video, slidecast, game, interactive website, etc.), or using other appropriate equipment. Where possible, new media posters and installations will be thematically grouped in sessions to enable broader discussion.

    New Media Performance/Presentation: 1-to-75-minute new media performances and presentations use digital tools – whether audio, visual, or multimedia – to create art in any form (animation, dance, poetry, music, video, drama, etc.).

    Mini-workshops: 75-minute sessions provide a highly interactive space for engaging participants in novel curricular approaches, development of action plans for addressing a pressing instructional dilemma, learning a new technological skill, or innovative technological developments in the field.

    Mentoring Workshops: These 75-minute interactive sessions are designed to extend the work of the Graduate Research Network throughout the conference, or to offer other opportunities for mentoring and professional development to new participants in the field. Proposals should include a clear explanation of activities. Registration for accepted sessions will be available prior to the conference.

    Half-day or Full-day Workshops: 3- or 6-hour workshops offer opportunities for engaged and in-depth introductions to new developments or current issues. Proposals should include a schedule and clear explanation of activities.

    Panels or Roundtables: 75-minute sessions consist of three to four 10- to 15-minute presentations or five to seven 5-minute conversation starters linked around a single topic. At least 20 minutes should be allocated for discussion. Proposals should include a brief overview of the topic and of each speaker's role. Priority will be given to proposals that foreground interaction or exchange among panelists and/or audience.

    Individual Presentations in Search of a Panel: 15-minute presentations will be combined with other individual submissions to create a coherent panel. Presenters will be expected to contact one another in advance of the conference to plan dialogue and exchange among panelists and/or with the audience.

    To submit a proposal, please visit the conference website. http://sweetlandcandw2011.com

    Please send any questions or comments to the conference organizers--Anne Gere, Naomi Silver, and Shelley Manis--at sweetlandcandw2011@umich.edu.

    cfp categories: african-americanamericanecocriticism_and_environmental_studiesfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsgraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryinternational_conferencesmodernist studiespopular_cultureprofessional_topicsrhetoric_and_compositionscience_and_culturetheatretheorytwentieth_century_and_beyond 39024"Cultural Form, Spatial Dialectics, and the Question of Autonomy"ACLA, (03/31 - 04/03, 2011)nilgesm@gmail.com1288705715african-americanamericancultural_studies_and_historical_approachesecocriticism_and_environmental_studiesethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualityinterdisciplinaryinternational_conferencespoetrypopular_culturepostcolonialtheorytravel_writingtwentieth_century_and_beyondfull name / name of organization: ACLA, (03/31 - 04/03, 2011)contact email: nilgesm@gmail.com

    Has the spatial dialectic that critics like Fredric Jameson ("Third-World Literature in the Age of Multinational Capital" and _Valences of the Dialectic_) and Franco Moretti ("Conjectures on World Literature") have recently described as fundamental to our understanding of cultural flows already exhausted itself? Much scholarship that attempts to trace the importation of literary forms in order to historicize the material and geopolitical history of transnational exchanges seems compelled to seek literary artifacts from earlier periods in order to illustrate the ways in which that history has been brought to bear on the relationship between specific literatures. What are we to make of the fact that theory seems to be experiencing a temporal lag, proclaiming with great urgency the need for a contemporary study of those cultural exchanges for which there no longer appear to be any examples in the present? Or, approaching the problem from a different angle, if the current geopolitical and material structures have made it impossible to maintain the distinction between cultural autonomy and subsumption — impossible, that is, to speak of more or less autonomous global spaces — then how does culture continue to function as a means of mapping (cognitively and otherwise) the differences between specific national and historical situations? What is the relationship between contemporary culture and the production of spatial difference itself?

    This seminar intends to take the exhaustion of conceptual distinctions such as first-world/third-world and core/periphery as an occasion to launch an inquiry into the notion of a contemporary spatial dialectic. Consequently, we invite papers that explore contemporary examples of formal and generic manifestations of spatial cultural flows.

    cfp categories: african-americanamericancultural_studies_and_historical_approachesecocriticism_and_environmental_studiesethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualityinterdisciplinaryinternational_conferencespoetrypopular_culturepostcolonialtheorytravel_writingtwentieth_century_and_beyond 39025[UPDATE] Re-thinking the Monstrous: Violence and Criminality in Society (NEW DEADLINE 11/30/2010, dates 7/1-3/2011, Munich)Ludwig-Maximilians-University Munichmonsterconference2011@gmail.com1288707401african-americanamericanchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualityhumanities_computing_and_the_internetinterdisciplinaryinternational_conferencesmedievalmodernist studiespoetrypopular_culturepostcolonialreligionrenaissanceromanticscience_and_culturetheatretheorytwentieth_century_and_beyondvictorianfull name / name of organization: Ludwig-Maximilians-University Munichcontact email: monsterconference2011@gmail.com

    Due to recent responses, we have extended the abstract deadline to 30 November 2010 for the following:

    Confirmed Keynote Speakers: Prof. Dr. Peter Becker (Johannes Kepler Universität Linz)
    Prof. Dr. David Schmid (University of Buffalo)
    Dr. Niall Scott (University of Central Lancashire)
    Dr. Margrit Shildrik (Queen's University, Belfast)

    In current theories of violence and crime, the monstrous has come to signify the non-human or the amalgamation of the human and its 'other', representing the embodiment of socially deviant behavior, or associated with physical disfigurement and mental disability, or excessive physical strength and exceptional intellectual capacity. Consequently, the monstrous has always played into the image/portrayal of the criminal, and has always been in the centre of attention - generating fear, repulsion, as well as fascination. Engaging with the prevailing antagonisms and dichotomies that surround and the monstrous, this interdisciplinary conference seeks to re-think, re-evaluate and reposition the correlation of this concept with issues o criminality and violence. We welcome proposals that consider the monstrous and its position in the discourse of violence and crime in relation to contemporary theoretical models, social and historical contexts, scientific developments, and other fictional and non-fictional influences. We are particularly interested in work that pursues an interdisciplinary approach.

    Possible topics include:
    The monstrous/monsters in fiction and film
    Neuroscience and criminal biology
    Body-modification, mutilation, dismemberment and criminality
    Cyborgs, androids, technophobia, and monstrous technologies
    Gothic and the monstrous
    Monstrosity and exclusion – crime as stigma
    Terror, trauma, anxiety, and (social) paranoia
    Containment, repression and criminal intent
    The (anti-)aesthetics of monstrosity
    Monstrosity and gendered crime
    (Forensic) pathologies of the monstrous

    Abstracts in English between 250-300 words for papers of 20 minutes to be given in English are invited by 30 November 2010. The abstract should also include a 50-word biographical note and AV requests. We will send acceptances by 1 January 2011.

    Conference Organisers: Malcah Effron, David Palatinus, and Ingrida Povidisa
    Supported by: Prof. Dr. Christian Begemann (Ludwig-Maximilians-University Munich)
    Contact Details: monsterconference2011_at_gmail.com
    Abstract Deadline: 30 November 2010

    cfp categories: african-americanamericanchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualityhumanities_computing_and_the_internetinterdisciplinaryinternational_conferencesmedievalmodernist studiespoetrypopular_culturepostcolonialreligionrenaissanceromanticscience_and_culturetheatretheorytwentieth_century_and_beyondvictorian 39026[UPDATE] Black and Brown Feminisms in Hip Hop Media University of Texas at San Antonio - March 4-5, 2011 Submission deadline: NoUniversity of Texas at San Antonioblackandbrownfeminisms@gmail.com 1288711204african-americanamericancultural_studies_and_historical_approachesethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualityhumanities_computing_and_the_internetinterdisciplinarypopular_culturepostcolonialtheorytwentieth_century_and_beyondfull name / name of organization: University of Texas at San Antoniocontact email: blackandbrownfeminisms@gmail.com

    UTSA presents Black and Brown Feminisms in Hip Hop Media with keynote address by Gwendolyn Pough, Associate Professor of Women's and Gender Studies at Syracuse University and featured speaker G. Henderson, Professor of English at University of North Carolina, Chapel Hill.

    This interdisciplinary conference will feature unpublished work on women in Hip Hop to exchange ideas, share research, and initiate a sustained conversation by and about Black and Brown women in Hip Hop media. Vital to this discussion is attention to the blurring lines between Black and Latina feminist studies and a dialogue that attempts to understand an interweaving history of objectification, struggle, and potential for agency. How do we read Black and Brown women in Hip Hop culture? What readings of Black and Brown women other than conventional black feminist readings and Latina feminist analyses are cogent? What theories enable those readings? Finally, what would an investigation into autobiographical stories of video models yield? How would those narratives differ from that of more conventional readings?

    A select number of accepted papers will be included in a one-day, academic conference at the University of Texas at San Antonio as a part of UTSA's celebration of Women's History Month on March 4, 2011 with a Hip Hop performance from local Texas as well as national hip hop artists on the evening of March 5, 2011. This conference will be an opportunity for presenters to share views and concerns on the growing intersections between Black and Brown women in hip hop culture. Possible Panel Topics Include:

    Interdisciplinary Approaches to Gender and Race in Hip Hop
    Colorism within Hip-Hop video culture
    The New Female Entrepreneur
    Negotiating Sexualities
    Black and Latina Diasporas
    Video Vixens or Video Models?
    Female Rappers
    Queer Identities
    Chicana/o Rap
    Alternative Models of Black Femininity
    Latinas in Video Model Culture
    Intersections of Video Models with Youth Culture
    Performing the Black Body/ Brown Body
    Reggaeton
    Able-Bodied Privilege in Hip Hop Feminisms
    A Case Study of Karrine Steffans
    Strip Club Culture
    Confessions of Video Vixens
    Eroticism vs. Pornography
    Women as Exchange among a Male Economy

    Please submit a 500 word abstract to Kinitra Brooks and/or Marco Cervantes blackandbrownfeminisms@gmail.com on or before November 15, 2010.
    Required registration for the conference will be $40.

    cfp categories: african-americanamericancultural_studies_and_historical_approachesethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualityhumanities_computing_and_the_internetinterdisciplinarypopular_culturepostcolonialtheorytwentieth_century_and_beyond 39027Graduate Student Conference: Shakespeare: Pedagogy, Scholarship, PerformanceMary Ruth Marotte, Graduate Director, University of Central Arkansasmrmarotte@uca.edu1288714955general_announcementsgraduate_conferencesinterdisciplinaryrenaissancetheatrefull name / name of organization: Mary Ruth Marotte, Graduate Director, University of Central Arkansascontact email: mrmarotte@uca.edu

    Call for Papers
    UCA's Fourth Annual
    English Graduate Conference on Literature

    Shakespeare:
    Pedagogy, Scholarship, and Performance

    April 14-15, 2010
    University of Central Arkansas

    When Ben Jonson wrote that William Shakespeare was "not of an age, but for all time," he could not have realized the full impact of his words. Nearly 400 years after his death, the bard still mesmerizes us. We invite papers on any aspect of Shakespearean studies.

    Though the conference theme centers on Shakespeare, we also welcome submissions on any topic related to all genres of literature, theory, culture, and film, as well as creative submissions of poetry, fiction, and drama.

    250-word abstracts and/or panel proposals must be emailed by March 15, 2010 to net06001@uca.edu with "Conference Submission" in the subject line.

    Keynote Speaker:
    Jacqueline Vanhoutte, Associate Professor of English, University of North Texas
    Dr. Vanhoutte earned a B.A. in English Literature from Carleton College and a Ph.D. from the University of Washington. She has published a number of essays on early English drama and court culture; her most recent article, entitled "Elizabeth I as Stepmother," appeared in ELR: English Literary Renaissance. Dr. Vanhoutte is also the author of Strange Communion: Motherland and Masculinity in Tudor Plays, Pamphlets, and Politics (University of Delaware Press, 2003) and co-author, with Laurel Amtower, of A Companion to Chaucer and His Contemporaries (Broadview, 2009). She is currently at work on a book about Shakespeare and the Elizabethan court, tentatively entitled ¬Age in Love: Shakespeare at the Court of Elizabeth I."

    Guest Poet:
    Greg Alan Brownderville is a native of Pumpkin Bend, Arkansas. Winner of the 2007 Porter Prize, Brownderville has published a substantial body of work in journals and magazines such as the Oxford American and Measure. Primarily a poet, Greg is also a folklorist and a writer of fiction, creative nonfiction, and literary criticism. His latest collection is Deep Down in the Delta.

    Sponsored by the University of Central Arkansas Department of English and Sigma Tan Delta

    cfp categories: general_announcementsgraduate_conferencesinterdisciplinaryrenaissancetheatre 39028Cinevisto: Journal of Hispanic and Lusophone CinemasCaryn Connelly and Luis Guadano, General Editorsconnellyc1@nku.edu OR luisguadano@weber.edu1288715601cultural_studies_and_historical_approachesethnicity_and_national_identityfilm_and_televisioninterdisciplinaryjournals_and_collections_of_essayspopular_culturetwentieth_century_and_beyondfull name / name of organization: Caryn Connelly and Luis Guadano, General Editorscontact email: connellyc1@nku.edu OR luisguadano@weber.edu

    We are currently soliciting manuscripts for the inaugural issue of Cinevisto: Journal of Hispanic and Lusophone Cinemas, a peer-reviewed journal that focuses on film production in the Spanish and Portuguese languages, as well as films relevant to or produced by members of Hispanic and Lusophone communities in their respective diasporas, such as U.S. Latinos. Cinevisto seeks to place a particular emphasis on films that are widely circulated and consumed in their context of production, looking to move beyond the more exclusivist "art house" cinema that often gets recognized in academic forums. We seek to move out of explored territories and open the discussion to films that have enjoyed success in the Hispanic and Lusophone world, regardless of their international export. For the first issue we invite essays that specifically address the overarching theme of the journal: cine visto, that is, films that have garnered a significant audience in their countries of origin and that bring to the fore questions of how the viewing public is defined. We are especially interested in essays that privilege films not widely distributed in North American niche audiences or that cater to pedagogical demands in the US, but rather that speak to cultures of cinema in a particular context of production. In short, what films are seen and why?

    The first issue is scheduled to be up and available by September 2011. To this end, the submission deadline for the inaugural issue is MARCH 15, 2011. Following issues of Cinevisto will be published annually, and submissions will be reviewed as they are received. Please share this CFP with colleagues interested in Hispanic and Lusophone cinemas.

    For further details, including submission guidelines, visit us at: http://organizations.weber.edu/cinevisto/default.html

    cfp categories: cultural_studies_and_historical_approachesethnicity_and_national_identityfilm_and_televisioninterdisciplinaryjournals_and_collections_of_essayspopular_culturetwentieth_century_and_beyond 39029ALA 2011 Roundtable: Websites of American Author Societies: What Are Their Goals? American Literature Associationcampbelld@wsu.edu1288718084african-americanamericanhumanities_computing_and_the_internettwentieth_century_and_beyondfull name / name of organization: American Literature Associationcontact email: campbelld@wsu.edu

    Call for Roundtable Participants: "Websites of American Author Societies: What Are Their Goals? Who Are They For?"
    American Literature Association conference, Boston, May 26–29, 2011

    The aim of the roundtable is to take stock of what American author societies are doing with their websites. Almost all such sites act as networks among specialized scholars, but some reach out to broader audiences--to general readers, teachers, graduate and undergraduate students, librarians, or others. Almost all sites seek to promote the work of their authors, but they have far different ideas about what promotion consists of. Some sites are small, simple, unadorned; some are large, complex, lavish. Some have special areas for kids, some have their own shops, some offer awards, some have commercial links, some are updated daily. . . .

    The roundtable will act as a forum for considering the role that American author society websites play for different audiences today.

    Please submit by January 10, 2011, a one-page statement about your experience with or interest in the maintenance of an American author society website.

    Donna Campbell
    Washington State University
    campbelld@wsu.edu

    Bernard Koloski
    Kate Chopin International Society
    bkoloski@katechopin.org

    Note: ALA convention participants may present a paper at a panel and also chair a session or participate in a roundtable.

    cfp categories: african-americanamericanhumanities_computing_and_the_internettwentieth_century_and_beyond 39030[UPDATE] Comparative Anatomies: Atlantic Science & the Literature of Slavery [Deadline Extended: 11/12/10] ACLA 2011, VancouverBritt Rusert, Temple University brusert@temple.edu1288721412african-americanamericanecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityinterdisciplinarypostcolonialscience_and_culturetheoryfull name / name of organization: Britt Rusert, Temple University contact email: brusert@temple.edu

    This seminar will explore the ways that comparative literatures of slavery, as well as the history of slavery itself, might be re-mapped by attending to dynamic networks of science and knowledge production across the Atlantic World. While various fields have moved toward a more global theorization of slavery (comparative histories of slavery, postcolonial approaches, an increasingly hemispheric Southern Studies, ongoing investigations into the Black Atlantic, and so on), the history of science as it pertains to race and enslavement remains, for the most part, confined within problematic frameworks of the nation-state. In U.S. contexts, for example, scholars often repeat the truism that institutions of slavery were perpetuated by a powerful American race science that emerged with the rise of comparative anatomy and related sciences in the late eighteenth century. But eighteenth- and nineteenth-century race science was actually composed of a diverse set of fields, theories, experiments, and knowledges that were produced and circulated throughout the Northern and Southern Americas as well as in Europe and Africa. This seminar will focus on the Atlantic circulation of experimental science in order to probe and challenge the national borders of literatures of enslavement. We will be especially interested in exploring alternative knowledge practices that challenged scientific racism as well as minor sciences that mobilized the experimentalism of empiricism in the struggle for emancipation.

    Interested parties should submit a 250-word proposal and 50-word bio through the ACLA website:

    http://www.acla.org/acla2011/?page_id=33. The ACLA annual meeting is organized as a series of seminars, where 12-15 scholars meet during a 2-3 day seminar to present papers and engage in discussion around a common theme of interest.

    The deadline for submissions has been extended to November 12, 2010.

    Please contact brusert@temple.edu with questions or for more information

    cfp categories: african-americanamericanecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityinterdisciplinarypostcolonialscience_and_culturetheory 39031ACLA Seminar: Emergent Authenticity: Fakes, Copies, and the Real Thing in a Global CultureRussell Cobb / University of Albertacobbrussell@gmail.com1288722454americancultural_studies_and_historical_approachesethnicity_and_national_identitygeneral_announcementsinterdisciplinaryinternational_conferencespopular_culturetheorytravel_writingtwentieth_century_and_beyondfull name / name of organization: Russell Cobb / University of Albertacontact email: cobbrussell@gmail.com

    How does a cultural product come to be accepted as authentic rather than a mere commodity? In 1999, for example, the Cuban government proclaimed that hip-hop was a genre in keeping with an "authentic expression of Cuban culture" after many years of being rejected as a symptom of capitalist excess. Why is Tex-Mex cuisine rejected by literary food writers while other regional varieties of Mexican cuisine are hailed as authentic in North American cookbooks? The idea of this seminar is to examine why the notion of the authentic remains such a touchstone in an increasingly globalized, hybrid culture.

    From Mexican food, to alternative music, to the market for rare books and manuscripts, the idea of an authentic culture seems to resist decades of critiques of social constructivism and postmodernism. Who constructs notions of authenticity and how are they reinforced? In this seminar, we hope understand how authenticity is not simply an objective criteria an expert can determine, but rather an unspoken negotiation between Self and Other. I am looking for colleagues who want to investigate interrogate the authentic and related concepts (perhaps "realism" in literature or the "invention of tradition" in history or anthropology). I'm especially interested in working with people who might have an interest in looking at the economic aspect of authenticity, since the concept often works in opposition to the idea of a "commodity."

    Submit here
    http://www.acla.org/submit/index.php?override=xyzzy

    cfp categories: americancultural_studies_and_historical_approachesethnicity_and_national_identitygeneral_announcementsinterdisciplinaryinternational_conferencespopular_culturetheorytravel_writingtwentieth_century_and_beyond 39032The Atrium: A Journal of Academic VoicesThe Atrium/Ivy Tech Community Collegenriecken@ivytech.edu1288723691americanchildrens_literaturecultural_studies_and_historical_approachesethnicity_and_national_identitygender_studies_and_sexualitygeneral_announcementshumanities_computing_and_the_internetinterdisciplinaryjournals_and_collections_of_essaysmodernist studiespoetryrhetoric_and_compositiontheoryfull name / name of organization: The Atrium/Ivy Tech Community Collegecontact email: nriecken@ivytech.edu

    The Atrium: A Journal of Academic Voices is a peer-reviewed cross-disciplinary journal that invites and encourages innovative, creative and critical articles that spur academic discourse across the disciplines in two- and four-year colleges. Articles published will be those of interest to a broad range of disciplines. We are interested in limited amounts of fiction and poetry, controversial topics in the academy, and articles that cross boundaries. We seek papers that describe best practices and student engagement of controversial topics. The Atrium intends to be a passageway of ideas and practice across the disciplines. There is, after all, a murky landscape that practitioners must traverse on their way from Learning Theory to Instructional Practice: Accepting the possibility that no theory is panacea, The Atrium acknowledges the value of discourse in the project of uncovering the principles that might govern the development of Best Practices. We publish electronically in the Fall and Spring. Submissions are ongoing, but the deadline for submissions to the Spring issue is January 1, 2011.
    The Atrium is a publication of the Northwest Region of Ivy Tech Community College, reputedly the largest community college system in the United States.
    For our current issue, submission guidelines, and e-mail submissions, please go to http://nwi.ivytech.edu/atrium/ For questions not addressed on the website, please contact the general editor, Nancy Riecken, at nriecken@ivytech.edu.

    cfp categories: americanchildrens_literaturecultural_studies_and_historical_approachesethnicity_and_national_identitygender_studies_and_sexualitygeneral_announcementshumanities_computing_and_the_internetinterdisciplinaryjournals_and_collections_of_essaysmodernist studiespoetryrhetoric_and_compositiontheory 39033Relationship Status: It's Complicated - University of Pittsburgh - February 24-25 2011The University of Pittsburgh French and Italian Graduate Student Association pitt.frit.conference@gmail.com1288724116classical_studiescultural_studies_and_historical_approacheseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygraduate_conferencesinterdisciplinarymedievalmodernist studiespoetrypopular_culturepostcolonialreligionrenaissanceromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondfull name / name of organization: The University of Pittsburgh French and Italian Graduate Student Association contact email: pitt.frit.conference@gmail.com

    This two-day conference aims to center its discussion around the role of various contacts in a multitude of relationships within French and Italian studies. Participants are invited to consider the instances and implications of conflict, aggression, collaboration, pleasure, and desire within these voluntary or forced groupings, ranging from literature to cultural studies and beyond. Relevant themes and topics may include, but are not limited to the following relationships:

    Colonizer/Colonized
    Author/Reader
    Citizen/Government
    Real/Virtual
    Teacher/Student
    Parent/Child/Siblings
    Love/Hate
    Friend/Foe
    Nation/Region
    Human/Natural World
    Queer/Normative
    Subject/Monarch

    We welcome abstracts from graduate and undergraduate students in all humanities and social science disciplines as well as all time periods. Presentations in English will be limited to a reading time of 20 minutes (8-10 pages). MLA-style abstracts of no more than 250 words should include a cover letter indicating the title, author's name, affiliation, address, telephone number, and e-mail address.

    Deadline for submission: November 15, 2010.

    Please send your abstract via email to:
    Maeva Mateos and Lauren Emerick, Department of French and Italian University of Pittsburgh; Cathedral of Learning 1328
    E-mail: pitt.frit.conference@gmail.com

    cfp categories: classical_studiescultural_studies_and_historical_approacheseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygraduate_conferencesinterdisciplinarymedievalmodernist studiespoetrypopular_culturepostcolonialreligionrenaissanceromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyond 39034American Indian/Indigenous Film [UPDATE]PCA/ACA & Southwest/Texas Popular Culture and American Culture Associations marubbio@augsburg.edu1288724649ethnicity_and_national_identityfilm_and_televisionfull name / name of organization: PCA/ACA & Southwest/Texas Popular Culture and American Culture Associations contact email: marubbio@augsburg.edu

    Call for Papers: American Indian/Indigenous Film Area

    PCA/ACA & Southwest/Texas Popular Culture and American Culture Associations
    Joint Conference
    April 20-23, 2011
    San Antonio, TX
    http://www.swtxpca.org
    Proposal submission deadline: December 15, 2009

    Conference hotel: Marriott Rivercenter San Antonio
    101 Bowie Street
    San Antonio, Texas 78205 USA
    Phone: 1-210-223-1000

    The American Indian/Indigenous Film Area is looking for panels, papers, screenings of Indigenous films + discussion, and workshops on topics related to American Indian, First Nations, and Indigenous film. We welcome proposals from all disciplines that examine, utilize, promote, or teach Native/Indigenous film and media are welcome. The American Indian/Indigenous Film Area is particularly interested in bringing together Native filmmakers and Native/non-Native academics to talk about the burgeoning field of Indigenous Film.

    Some topics might include, but are not limited to:
    · Native women filmmakers
    · American Indian/Indigenous Film and/or filmmakers
    · New Voices in Native/Indigenous film and media
    · Needs, Access, and Issues in Native/Indigenous film
    · The outcomes/consequences of using Native films across cultural boundaries and in comparison to other cultural approaches.
    · Teaching American Indian or Indigenous films as part of a non‑American Indian Studies course, such as Humanities, American Studies, or English.
    · Disciplinary and cultural politics as they influence how we read Native film
    · American Indians in Hollywood film
    · Approaches to teaching American Indian film
    · Indian and the Western (this could also apply to how Indigenous people globally are positioned as "Indians" in national "Western" genres)
    · Effects/impacts of Native representations in film/media on Native and non-Native culture
    · Showcasing new work (if you would like to facilitate a panel that screens new work, please do so). We will need to know in advance what film you wish to have screened, its length, etc. so that we can schedule a screening time followed by a discussion period.

    If you have specific ideas for topics, workshops, or panels that are not listed here, please submit those as well.

    Native filmmakers, scholars, teachers, students, professionals, and others are encouraged to participate. Graduate students may wish to submit papers for fellowships and awards.
    Further information regarding the conference (listing of all areas, hotel, registration, tours, etc) can be found at http://swtxpca.org/documents/130.html. Register early for a discount rate and to reserve space at the conference hotel—rooms fill quickly.

    Please send 100-200 word abstracts to:

    M. Elise Marubbio,
    Associate Professor & Director Augsburg Native American Film Series
    Area Chair, American Indian/Indigenous Film SW/TX PCA/ACA
    CB 115
    Augsburg College
    2211 Riverside Avenue
    Minneapolis, MN 55454
    (612) 330-1523
    marubbio@augsburg.edu

    cfp categories: ethnicity_and_national_identityfilm_and_television 39035Canada, Irishness and Performance: Opening the Debate [Conference: April 15-16 2011; Proposals Due: Dec 17, 2010]Irish Theatrical Diaspora project at the Graduate Centre for Study of Drama, University of TorontoITD2011@gmail.com1288726320cultural_studies_and_historical_approachesethnicity_and_national_identityinternational_conferencestheatrefull name / name of organization: Irish Theatrical Diaspora project at the Graduate Centre for Study of Drama, University of Torontocontact email: ITD2011@gmail.com

    The history of Irish diasporas in Canada is rich and diverse, and the Irish have contributed significantly to the creation of Canadian cultural phenomena, yet the study of Irish theatre in terms of Canadian diasporic identities has not produced an equally rich body of literature.

    With this scholarly lacuna in mind, this conference aims to address the scope and character of Irish influence on performance in Canada, with particular attention to the ideas of multi- and inter-culturalism. 'Performance' in this case includes theatre, dance, spectacle, and all aspects of the performing arts, as well as extra-theatrical activity – such as parades and community gatherings – that foreground 'Irishness' in some way. Canada has a well-established multicultural identity, whereas Ireland is just beginning to negotiate a civil society that is constituted by a variety of residents from different ethnic and racial backgrounds. How does Irish performance fit into the Canadian cultural 'mosaic'? Furthermore, what kinds of Irish plays are being produced in Canada, and how do these performances negotiate the relationship between Irish culture and Canadian culture? How is 'Irishness' performed in Canada, and from this, what can we learn about the mechanisms and character of cultural exchange? And finally, what is the state of academic activity concerning Irish performance and Canada?

    Keynote speakers include Ann Saddlemyer (Professor Emeritus, University of Toronto), Jackie Maxwell (Artistic Director of the Shaw Festival), and Lisa Fitzpatrick (Director of Drama, University of Ulster - Derry).

    Possible topics include:

    - Irish theatre on Canadian stages
    - Impact of Irish theatre professionals in Canada
    - Irish influence on Canadian drama
    - Multi-/inter-culturalism in Toronto and Irish performance
    - Irishness and Canada's 'Celtic' east coast
    - Performing Irish identity in Canadian society (drama and arts groups, pubs, community centres).
    - St. Patrick's Day parades in Canada
    - Orange Lodges and performance in Canada
    - Performing the Famine in Canada

    Submit: Proposals (max. 250 words) along with a brief bio and contact details.
    Deadline: Friday, December 17, 2010
    Contact: Please send proposals and CFP-related queries, preferably by email, to the conference organizer:

    Dr. Natalie Harrower
    School of English
    Trinity College Dublin
    Dublin 2, Ireland
    ITD2011@gmail.com

    The conference organizers welcome applications from scholars at any stage of their career, and particularly encourage graduate students to submit proposals. For more information on Irish Theatrical Diaspora personnel, conferences and publications, please visit www.irishtheatricaldiaspora.net

    cfp categories: cultural_studies_and_historical_approachesethnicity_and_national_identityinternational_conferencestheatre 39036Transnational Star ReaderProfessors Russell Meeuf and Raphael Raphaelrraphael@hawaii.edu, rmeeuf@uidaho.edu1288727539americancultural_studies_and_historical_approachesfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsinterdisciplinarypopular_culturefull name / name of organization: Professors Russell Meeuf and Raphael Raphaelcontact email: rraphael@hawaii.edu, rmeeuf@uidaho.edu

    Call for Papers:
    The Transnational Star Reader

    The editors of The Transnational Star Reader are seeking innovative scholarship on the phenomenon of transnational stars. The collection will include a variety of existing work by established scholars in the field as well as new scholarship from a range of perspectives. Essays should address the transnational circulation of star texts or star-centered media, the importance of transnational stardom to international media industries, or global star culture(s). Essays may be historical or contemporary, theoretical discussions or case studies, political economic analyses or cultural studies semiotics, or anything in between.

    In particular, we are seeking essays that broadly address (but are not necessarily limited to) the following questions:

    How and why do certain stars or celebrities translate across diverse national and/or cultural borders?

    Do existing theories of stars and society adequately explain transnational celebrity?

    How has star culture changed in an era of globalization?

    What is the relationship between stars and the international media industry?

    What are the international/transnational cultural contexts for understanding specific stars or the phenomenon of stardom?

    Please submit a succinct abstract (300 word maximum) by January 31, 2011. In addition, please include a brief academic bio (maximum 50 words). Authors are asked to note the status of the project (finished project, work in progress, or proposed essay) and provide a timeline for completion, if applicable. Email submissions or queries to Russell Meeuf
    (University of Idaho) rmeeuf@uidaho.edu or Raphael Raphael (University of Hawaii at Manoa) rraphael@hawaii.edu. Please put "TSR Submission" in the subject heading of submission emails.

    cfp categories: americancultural_studies_and_historical_approachesfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsinterdisciplinarypopular_culture 39037Technologies of Global Cinema - Nov. 12th - ACLA 2011 SeminarJonathan Foltz/Princeton Universityjfoltz@princeton.edu1288729629african-americanamericancultural_studies_and_historical_approachesecocriticism_and_environmental_studiesethnicity_and_national_identityfilm_and_televisioninterdisciplinarymodernist studiespopular_culturepostcolonialtwentieth_century_and_beyondfull name / name of organization: Jonathan Foltz/Princeton Universitycontact email: jfoltz@princeton.edu

    Technologies of Global Cinema

    ACLA 2011 Annual Meeting: World Literature, Comparative Literature

    Vancouver March 31 - April 3rd, 2011

    Seminar Organizer: Jonathan Foltz, Princeton U (jfoltz@princeton.edu)

    Writing in 1928, the American poet H.D. axiomatically noted that "the world of film today (there is no getting away from it) is no longer the world of the film, it is the world. It is only those who are indifferent to the world itself and its fate, who can afford to be indifferent to the fate of the film industry and the fate of film art." If this claim now seems self-evident, it may simply indicate just how thoroughly our imagination of the world has been mediated by visual technologies.

    From the early notion that cinema offered a "universal language," to ontological claims about film's indexical neutrality, our current experience of global cinema is circumscribed by ideologies of film's ability to represent the world as a space of social and aesthetic coherence. This seminar invites papers that explore theoretical, historical, and/or institutional relays between the aesthetics and geopolitics of global film. How can we approach films in ways that address both their embeddedness within global economies and the fantasies of interconnection which they narrate? How do films use representations of natural landscapes and interplanetary travel to allegorize the political or apolitical territoriality of what we learn to accept as "the world"? What strategies of formal dissonance do films employ to make us question the transparency of these communities? Themes may include, but are not limited to, nature documentaries, science fiction films, colonial narratives, Third Cinema, experimental film, special effects, CGI, silent cinema, film theory, and institutional history.

    The deadline for proposals in Nov. 12th. Proposals have a limit of 250 words, and need to be submitted at the ACLA website in the following link:
    http://www.acla.org/submit/index.php?override=xyzzy

    cfp categories: african-americanamericancultural_studies_and_historical_approachesecocriticism_and_environmental_studiesethnicity_and_national_identityfilm_and_televisioninterdisciplinarymodernist studiespopular_culturepostcolonialtwentieth_century_and_beyond 39038Noncanonical Affects (ALA 2011, Boston, 5/26-5/29; proposals by 12/15/2010)Brian Sweeneybsweeney@umassd.edu1288733885african-americanamericancultural_studies_and_historical_approachesethnicity_and_national_identitygender_studies_and_sexualitypostcolonialscience_and_culturetheoryfull name / name of organization: Brian Sweeneycontact email: bsweeney@umassd.edu

    The affective turn in literary studies, according to Sianne Ngai, has worked to historicize certain emotions--sympathy, melancholia, shame--even as it has left unexamined the cultural roots of other, less privileged forms of feeling. This panel invites papers concerned with historicizing less "canonical" emotions by exploring their representation/production in literary texts of the eighteenth, nineteenth, and twentieth centuries.

    Especially welcome are papers which

    •foreground links between literary canonicity and affectivity;

    •situate texts within transnational affective structures and/or discourses; and/or

    •consider relationships and tensions between affect studies and the so-called "aesthetic turn."

    Please send abstract (250-500 words) and brief c.v. to Brian Sweeney bsweeney@umassd.edu by December 15.

    cfp categories: african-americanamericancultural_studies_and_historical_approachesethnicity_and_national_identitygender_studies_and_sexualitypostcolonialscience_and_culturetheory 39039[UPDATE] ALL IS FORTUNE (deadline extended to Nov. 8)Lynne M. Simpson & Kerri Lynne Tom / College English Associationlsimpson@presby.edu / Kerri.Tom@cui.edu1288746790renaissancefull name / name of organization: Lynne M. Simpson & Kerri Lynne Tom / College English Associationcontact email: lsimpson@presby.edu / Kerri.Tom@cui.edu

    42nd Annual Conference | March 31 - April 2, 2011 | St. Petersburg, Florida

    Submission deadline: November 8, 2010 at http://cea-web.org

    "Tis but fortune; all is fortune," Shakespeare warns us. Money, prosperity, luck, friendship, health, a warm place to sleep—or a lack thereof--matters. The College English Association, a collegial gathering of scholar-teachers in English studies, invites proposals for presentations on 16th and 17th century British literature for our 42nd annual conference on the theme of fortune.

    Submission: August 15 - November 1, 2010
    Please see the submission instructions at http://cea-web.org/. While papers that address the conference theme will be given priority, others will be welcome and carefully considered as well.

    Conference Theme: Fortunes
    In a world staggered by economic decline and natural catastrophes, what are the new boundaries of success and misfortune? How do art, literature, and the classroom respond to the Rota Fortunae? For our 2011 meeting, CEA invites papers and panels that explore Fortune as both a daunting challenge and an elusive ideal. For more information, please see the full CFP at http://cea-web.org/

    General Call for Papers
    CEA also welcomes proposals for presentations in any of the areas English
    departments typically encompass, including literature, creative writing,
    composition, technical communication, linguistics, and film. We also welcome
    papers on areas that influence our work as academics, including student
    demographics, student/instructor accountability and assessment, student
    advising, academic leadership in departments and programs, and the place of
    the English department in the university.

    Conference Location
    The Hilton St. Petersburg Bayfront
    333 First Street South, St. Petersburg
    Florida 33701
    (727) 894-5000

    Membership
    All presenters at the 2011 CEA conference must become members of CEA by
    January 1, 2011. To join CEA, please go to http://cea-web.org/

    More information
    * Get short, timely messages from CEA via Twitter: http://twitter.com/CEAtweet
    * Connect with CEA on Facebook:
    http://www.facebook.com/CollegeEnglishAssociation
    * Find out more about conference lodging and registration: http://cea-web.org/
    * Contact CEA officers: http://cea-web.org/

    Other questions? Email at cea.english@gmail.com or Lynne Simpson at lsimpson@presby.edu.

    Thank you for your interest,

    Lynne M. Simpson
    Professor of English
    Presbyterian College
    503 South Broad Street
    Clinton, SC 29235
    lsimpson@presby.edu

    and Kerri Lynne Tom
    Associate Professor of English
    Concordia University
    1530 Concordia West
    Irvine, California 92612-3203
    Kerri.Tom@cui.edu

    cfp categories: renaissance 39040[UPDATE] CEA 2011 Conference (Nov. 8; March 31-April 2)College English Associationcea.english@gmail.com1288748245african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsinterdisciplinaryinternational_conferencesmedievalmodernist studiespoetrypopular_culturepostcolonialprofessional_topicsreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorianfull name / name of organization: College English Associationcontact email: cea.english@gmail.com

    In response to requests for an extended deadline, the CEA will now accept proposals through Monday, November 8 for our 2011 Conference in St. Petersburg, Florida. Please see the CFP below.

    **NOTE: Each member of a joint presentation or pre-formed panel MUST submit a proposal individually to the CEA website.

    Call for Papers, CEA 2011 | FORTUNES
    42nd Annual Conference | March 31 - April 2, 2011 | St. Petersburg, Florida
    The Hilton St. Petersburg Bayfront, 333 First Street South, St. Petersburg,
    Florida 33701; (727) 894-5000

    EXTENDED DEADLINE: November 8, 2010 at http://cea-web.org/

    The College English Association, a gathering of scholar-teachers in English studies, welcomes proposals for presentations for our 42nd annual conference.

    Conference Theme: Fortunes
    Money, luck, friendship, health, a warm place to sleep. In a world staggered
    by economic decline and natural catastrophes, what are the new boundaries of success and misfortune? How do art, literature, and the classroom respond to
    the Rota Fortunae? For our 2011 meeting, CEA invites papers and panels that
    explore Fortune as both a daunting challenge and an elusive ideal. For more
    information, please see the full CFP at http://cea-web.org/

    Plenary Speaker: Andrew Delbanco, Columbia University

    General Call for Papers
    CEA also welcomes proposals for presentations in any of the areas English
    departments typically encompass, including literature, creative writing,
    composition, technical communication, linguistics, and film. We also welcome
    papers on areas that influence our work as academics, including student
    demographics, student/instructor accountability and assessment, student
    advising, academic leadership in departments and programs, and the place of
    the English department in the university.

    Membership
    All presenters at the 2011 CEA conference must become members of CEA by
    January 1, 2011. To join CEA, please go to http://cea-web.org/

    More information
    * Get short, timely messages from CEA via Twitter: http://twitter.com/CEAtweet
    * Connect with CEA on Facebook:
    http://www.facebook.com/CollegeEnglishAssociation
    * Find out more about conference lodging and registration: http://cea-web.org/
    * Contact CEA officers: http://cea-web.org/

    Other questions? Please email cea.english@gmail.com.

    Sincerely,

    Craig A. Warren
    First Vice President and Program Chair
    College English Association

    cfp categories: african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsinterdisciplinaryinternational_conferencesmedievalmodernist studiespoetrypopular_culturepostcolonialprofessional_topicsreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorian 39041Sleep: Aspects and Approaches. Oxford 12-13 April 2011Oxford Medieval Graduate Conference (Rob Avis, Sarah Baccianti, Brian FitzGerald)oxgradconf@gmail.com1288751656graduate_conferencesinterdisciplinarymedievalrenaissancefull name / name of organization: Oxford Medieval Graduate Conference (Rob Avis, Sarah Baccianti, Brian FitzGerald)contact email: oxgradconf@gmail.com

    This conference is aimed at early career scholars and graduate students. It is intended that a volume of proceedings comprising selected papers will appear in the Medium Ævum Monographs Series. Contributions are welcomed from diverse fields of research such as history of art and architecture, history, theology, philosophy, anthropology, literature and history of ideas.

    Papers will be 20 minutes or less. Please email 250-word abstracts (text only, no attachments please) to oxgradconf@gmail.com by 10th January 2011.

    Suggested topics might include:

    Dreams and dream vision; Nightmares; Interpretation of dreams
    Sleeplessness and insomnia; Pharmacology of sleep
    Architecture of bedrooms; Sleeping arrangements;
    Where people sleep; Who people sleep with
    Sleeping during the day, sleeping at night
    Sleep paralysis
    Eternal sleep
    Induced sleep and coma; unconsciousness
    Premonition
    The Seven Sleepers
    Saints, sleeping and hagiography
    Sleep-walking and sleep talking
    Sleeping clothed and unclothed
    Music, sleep and lullabies
    Sleeping habits
    Representation of sleep, dreams and nightmares in art and manuscripts

    The conference fee is expected to be £30 dining, £10 non-dining. We hope to organise a conference banquet in Lincoln's lovely hall on the Tuesday night and will provide details of this as soon as they are available. All updates and further information can be obtained from www.medieval.ox.ac.uk/omgc.html

    cfp categories: graduate_conferencesinterdisciplinarymedievalrenaissance 39042[UPDATE] Call for Papers: Alfred HitchcockSouthwest/Texas Popular & American Culture Association - Joint Conferencehowarth-m@mssu.edu1288752636americancultural_studies_and_historical_approachesethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementspopular_culturereligionrhetoric_and_compositionromantictheorytwentieth_century_and_beyondfull name / name of organization: Southwest/Texas Popular & American Culture Association - Joint Conferencecontact email: howarth-m@mssu.edu

    PCA/ACA & Southwest/Texas Popular Culture and American Culture Associations
    Joint Conference
    San Antonio, Texas
    April 20-23, 2011
    Marriott Rivercenter
    101 Bowie Street
    San Antonio, Texas 78205 USA
    Phone: 1-210-223-1000
    Submission Deadline: December 15th, 2010

    Conference Website: (updated regularly)

    Panels now forming for presentations on the films and career of Alfred Hitchcock. Listed below are some suggestions for possible presentations.

    • Hitchcock and Music
    • Hitchcock and Television
    • Hitchcock and Pedagogy
    • Hitchcock and Film Theory
    • Hitchcock and Film Genres
    • Hitchcock and Voyeurism
    • Hitchcock and the Silent Era
    • Hitchcock and Gender
    • Hitchcock and Black Humor

    This list of topics suggests a few possible ways to consider Alfred Hitchcock's work, but it is not final. Any other approaches to discussing the "master of suspense" are certainly welcome.

    Please send a 250 word abstract, as well as a current curriculum vitae, by December 15th 2010 to Michael Howarth at the e-mail or physical address below:

    Michael Howarth, Alfred Hitchcock Chair
    Assistant Professor of English
    Missouri Southern State University
    3950 E. Newman Road
    Kuhn Hall
    Joplin MO 64801
    417-625-3051
    Howarth-M@mssu.edu

    cfp categories: americancultural_studies_and_historical_approachesethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementspopular_culturereligionrhetoric_and_compositionromantictheorytwentieth_century_and_beyond 39043Innovative Studies: International Journal (ISIJ)Computer Science Journalscfp@cscjournals.org1288765110journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=ISIJ

    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February

    Journal: Innovative Studies: International Journal (ISIJ)
    Volume: 1 Issue: 3
    ISSN: 2180-2157
    URL: http://www.cscjournals.org/csc/description.php?JCode=ISIJ
    About ISIJ

    The Innovative Studies: An International Journal is an independent, peer-reviewed journal devoted to sharing ideas and discussing on science and technology innovations. It publishes scholarly and practitioner-oriented papers, books, case studies, review essays, and book reviews related to innovation, creativity, change management, case studies, technology strategy and planning etc.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for ISIJ.

    ISIJ List of Topics
    The realm of Innovative Studies: International Journal (ISIJ) extends, but not limited, to the following:
    • Change Management
    • Creativity
    • Diffusion of Innovation
    • Entrepreneurship/New Technology Start-Up
    • Environmental Issues in Technology Management
    • Innovation
    • Innovation in SME
    • Innovative Studies in Computer Science and Engineering Fields
    • Knowledge Assets and Management
    • Management of Emerging/Disruptive Technologies
    • New Product/Process Development
    • New Venture Management
    • Project and Program Management
    • R&D Management
    • Technology Alliances and Collaboration
    • Technology Assessment and Evaluation
    • Technology Strategy and Planning

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39044International Journal of Ergonomics (IJEG)Computer Science Journalscfp@cscjournals.org1288765734journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJEG
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Ergonomics (IJEG)
    Volume: 1 Issue: 1
    ISSN: 2180-2149
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJEG

    About IJEG
    Ergonomics concerns the optimum design of products, jobs and systems in relation to human beings. The original purpose of ergonomics was to enhance both the efficiency and well-being of the workforce. These days it applies to the efficiency and welding of human beings in all areas of life - from the factory floor to the home, from the airport terminal to the country road. The International Journal of Ergonomics (IJEG) is a peer reviewed journal; intended to be an outlet for theoretical and empirical research contributions from scholars and practitioners, concerned with the understanding of interactions among humans and other elements of a system.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJEG.

    IJEG List of Topics
    The realm of International Journal of Ergonomics (IJEG) extends, but not limited, to the following:

    • Applied Ergonomics
    • Cognitive Ergonomics
    • Community Ergonomics
    • Cooperative Work
    • Crew Resource Management
    • Ergonomics
    • Ergonomics and Society
    • Ergonomics in the Workplace
    • Human Factors
    • Human Factors and Ergonomics in Manufacturing
    • International Journal of Industrial Ergonomics
    • Macroergonomics
    • Mobile Ergonomics
    • New Work Programs
    • Occupational Safety and Ergonomics
    • Organizational Ergonomics
    • Physiological Studies
    • Repetitive Movements
    • Safety and Health
    • Seating Ergonomics
    • Telework
    • Theoretical Issues in Ergonomics Science
    • Travail Humain
    • Virtual Organizations
    • Workplace Layout

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39045International Journal of Business Research and Management (IJBRM)Computer Science Journalscfp@cscjournals.org1288766176journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJBRM
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Business Research and Management (IJBRM)
    Volume: 1 Issue: 3
    ISSN: 2180-2165
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJBRM

    About IJBRM
    As a peer-reviewed journal, The International Journal of Business Research and Management (IJBRM) invite papers with theoretical research/conceptual work or applied research/applications on topics related to research, practice, and teaching in all subject areas of Business, Management, Business research, Marketing, MIS-CIS, HRM, Business studies, Operations Management, Business Accounting, Economics, E-Business/E-Commerce, and related subjects. IJRBM is intended to be an outlet for theoretical and empirical research contributions for scholars and practitioners in the business field.

    IJBRM establishes an effective communication channel between decision- and policy-makers in business, government agencies, and academic and research institutions to recognise the implementation of important role effective systems in organisations. IJBRM aims to be an outlet for creative, innovative concepts, as well as effective research methodologies and emerging technologies for effective business management

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJBRM.

    IJBRM List of Topics
    The realm of International Journal of Business Research and Management (IJBRM) extends, but not limited, to the following:

    • Accounting Economics
    • Any Other Interdisciplinary Research Relevant to Business, Research and Management
    • Business & Economics Education
    • Business Accounting
    • Business Law
    • Business Model and Strategy
    • Business Processes
    • Case Studies
    • Cross-Culture Issues in Business
    • Customer Relationship Management
    • Decision Support and Knowledge-based Systems
    • E-commerce, Collaborative Commerce and Net-enhancement
    • Economics Business and Economic Systems
    • Finance & Investment
    • General Business Research
    • General Management
    • Global Business
    • Globalisation, Business and Systems
    • Knowledge Management and Organisational Learning
    • Labor Relations & Human Resource Management
    • Management Information Systems
    • Management Systems and Sustainable Business
    • Managing Systems
    • Marketing Theory and Applications
    • Modelling Simulation and Analysis of Business Process
    • Organizational Behavior & Theory
    • Production and Operations Systems
    • Production/Operations Management
    • Public Administration and Small Business Entreprenurship
    • Public Responsibility and Ethics
    • Strategic Management and Systems
    • Strategic Management Policy
    • Supply Chain and Demand Chain Management
    • Technologies and Standards for Improving Business
    • Technology & Innovation in Business Systems
    • Technopreneurship Management
    • Trust Issues in Business and Systems
    • Value Chain Modelling Analysis Simulation and Management
    • Value-based Management and Systems
    • Virtual Communities and Business

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39046International Journal of Ubiquitous Computing (IJUC)Computer Science Journalscfp@cscjournals.org1288766311journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJUC
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Ubiquitous Computing (IJUC)
    Volume: 1 Issue: 4
    ISSN: 2180-1355
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJUC

    About IJUC
    The any place/any time/any means vision of ubiquitous computing has explosive impact on academics, industry, government and daily life. Following ubiquitous computers and networks, is a road towards ubiquitous intelligence, i.e., computational intelligence pervasion in both the physical world and the cyber world. Such right place/right time/right means vision of ubiquitous intelligence will greatly reform our world to create a smart world filled with a variety of embedded intelligence or smart real and virtual things ranging from software to hardware, from man-made artifacts to natural objects, from everyday appliances to sophisticated systems, etc.

    The International Journal of Ubiquitous Computing (IJUC) includes all aspects related to ubiquitous computing and ubiquitous intelligence as well as the smart world, with emphasis on methodologies, models, semantics, awareness, architectures, middleware, tools, designs, implementations, experiments, evaluations, and non-technical but crucial factors in the practical applications of ubiquitous computing and intelligence related to economics, society, culture, ethics and so on. IJUC objective is to provide an outstanding channel for academics, industrial professionals, educators and policy makers working in the different disciplines to contribute and to disseminate innovative and important new work in the broad ubiquitous computing areas and the emerging ubiquitous intelligence field. IJUC is a refereed international journal, providing an international forum to report, discuss and exchange experimental or theoretical results, novel designs, work-in-progress, experience, case studies, and trend-setting ideas. Papers should be of a quality that represents the state-of-the-art and the latest advances in methodologies, models, semantics, awareness, architectures, middleware, tools, designs, implementations, experiments, evaluations, applications, non-technical factors and stimulating future trends in ubiquitous computing areas.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJUC.

    IJUC List of Topics
    The realm of International Journal of Ubiquitous Computing (IJUC) extends, but not limited, to the following:

    • Ad Hoc Networking
    • Ambient Intelligence
    • Automated and Adapted Service
    • Context Acquisition and Representation
    • Context Adaptation Design
    • Context Analysis and Utilization
    • Context Database
    • Context Framework and Middleware
    • Context Management
    • Context Media Processing
    • Context-aware Computing
    • Context-Aware Systems (6 hours)
    • Contexts & the Context-Aware Life-Cycle
    • Embedded Software and Intelligence
    • Everyday UbiCom Applications
    • Intelligence Service Grid
    • Intelligent Network
    • Intelligent Sensor Network
    • Intelligent Web Service
    • location-Aware Application
    • Management of UbiCom Systems
    • Mobile Services
    • Mobility Dimensions & Design
    • Open Service Architecture
    • Real and Cyber World Semantics
    • Security Management in Ubiquitous Computing
    • Situated Service
    • Smart Objects and Environments
    • Spatial Awareness
    • Technology Compositing
    • Temporal Awareness & Composite Context Awareness
    • UbiCom Environments & Smart Environments
    • UbiCom System Properties for Smart Devices
    • Ubiquitous Communication (10 hours)
    • Ubiquitous Computing
    • Ubiquitous Intelligence Implications and Social Fa
    • Ubiquitous Intelligence Modeling
    • Ubiquitous Interaction and Intelligent Management
    • Ubiquitous Networking and Intelligent Services
    • Ubiquitous Networks Mobile
    • Ubiquitous Networks PLC PAN BAN
    • Ubiquitous Privacy and Trust
    • Ubiquitous wired and wireless Networks
    • Ubiquitous/Pervasive Platform and Middleware

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39047International Journal of Scientific and Statistical Computing (IJSSC)Computer Science Journalscfp@cscjournals.org1288766425journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJSSC
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Scientific and Statistical Computing (IJSSC)
    Volume: 1 Issue: 2
    ISSN: 2180-1339
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJSSC

    About IJSSC
    International Journal of Scientific and Statistical Computing (IJSSC) aims to publish research articles on numerical methods and techniques for scientific and statistical computation. IJSSC publish original and high-quality articles that recognize statistical modeling as the general framework for the application of statistical ideas. Submissions must reflect important developments, extensions, and applications in statistical modeling. IJSSC also encourages submissions that describe scientifically interesting, complex or novel statistical modeling aspects from a wide diversity of disciplines, and submissions that embrace the diversity of scientific and statistical modeling.

    IJSSC goal is to be multidisciplinary in nature, promoting the cross-fertilization of ideas between scientific computation and statistical computation. IJSSC is refereed journal and invites researchers, practitioners to submit their research work that reflect new methodology on new computational and statistical modeling ideas, practical applications on interesting problems which are addressed using an existing or a novel adaptation of an computational and statistical modeling techniques and tutorials & reviews with papers on recent and cutting edge topics in computational and statistical concepts.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJSSC.

    IJSSC List of Topics
    The realm of International Journal of Scientific and Statistical Computing (IJSSC) extends, but not limited, to the following:
    • Annotated Bibliography of Articles for the Statist
    • Bibliography for Computational Probability and Sta
    • Computational Statistics
    • Current Index to Statistics
    • Environment of Statistical Computing
    • Guide to Statistical Computing
    • Mathematics of Scientific Computing
    • Solving Non-Linear Systems
    • Statistical Computation and Simulation
    • Statistics and Statistical Graphics
    • Symbolic computation
    • Theory and Applications of Statistics and Probabil

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39048International Journal of Software Engineering (IJSE)Computer Science Journalscfp@cscjournals.org1288766573journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJSE
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Software Engineering (IJSE)
    Volume: 1 Issue: 5
    ISSN: 2180-1320
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJSE

    About IJSE

    The International Journal of Software Engineering (IJSE) provides a forum for software engineering research that publish empirical results relevant to both researchers and practitioners. IJSE encourage researchers, practitioners, and developers to submit research papers reporting original research results, technology trend surveys reviewing an area of research in software engineering and knowledge engineering, survey articles surveying a broad area in software engineering and knowledge engineering, tool reviews and book reviews. The general topics covered by IJSE usually involve the study on collection and analysis of data and experience that can be used to characterize, evaluate and reveal relationships between software development deliverables, practices, and technologies. IJSE is a refereed journal that promotes the publication of industry-relevant research, to address the significant gap between research and practice.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJSE.

    IJSE List of Topics

    The realm of International Journal of Software Engineering (IJSE) extends, but not limited, to the following:

    • Application of Object-Oriented Technology to Engin
    • Architecting an OO System for Size Clarity Reuse E
    • Composition and Extension
    • Computer-Based Engineering Techniques
    • Data Modeling Techniques
    • History of Software Engineering
    • IDEF
    • Impact of CASE on Software Development Life Cycle
    • Intellectual Property
    • Iterative Model
    • Knowledge Engineering Methods and Practices
    • Licensing
    • Modeling Languages
    • Object-Oriented Systems
    • Project Management
    • Quality Management
    • Rational Unified Processing
    • SDLC
    • Software Components
    • Software Deployment
    • Software Design and applications in Various Domain
    • Software Engineering Demographics
    • Software Engineering Economics
    • Software Engineering Methods and Practices
    • Software Engineering Professionalism
    • Software Ergonomics
    • Software Maintenance and Evaluation
    • Structured Analysis
    • Structuring (Large) OO Systems
    • Systems Engineering
    • Test Driven Development
    • UML

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39049International Journal of Robotics and Automation (IJRA)Computer Science Journalscfp@cscjournals.org1288766718journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJRA
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Robotics and Automation (IJRA)
    Volume: 1 Issue: 5
    ISSN: 2180-1312
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJRA

    About IJRA

    Robots are becoming part of people's everyday social lives - and will increasingly become so. In future years, robots may become caretaking assistants for the elderly, or academic tutors for our children, or medical assistants, day care assistants, or psychological counselors. Robots may become our co-workers in factories and offices, or maids in our homes.

    The International Journal of Robotics and Automation (IJRA), a refereed journal aims in providing a platform to researchers, scientists, engineers and practitioners throughout the world to publish the latest achievement, future challenges and exciting applications of intelligent and autonomous robots. IJRA is aiming to push the frontier of robotics into a new dimension, in which motion and intelligence play equally important roles. IJRA scope includes systems, dynamics, control, simulation, automation engineering, robotics programming, software and hardware designing for robots, artificial intelligence in robotics and automation, industrial robots, automation, manufacturing, and social implications.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJRA.

    IJRA List of Topics

    The realm of International Journal of Robotics and Automation (IJRA) extends, but not limited, to the following:
    • Automation Control
    • Automation Engineering
    • Autonomous Robots
    • Biotechnology & Robotics
    • Emergence of The Thinking Machine
    • Forward Kinematics
    • Household Robots and Automation
    • Inverse Kinematics
    • Jacobian and Singularities
    • Methods for Teaching Robots
    • Nanotechnology & Robotics (Nanobots)
    • Orientation Matrices
    • Robot Controller
    • Robot Structure and Workspace
    • Robotic & Automation Software Development
    • Robotic Exploration
    • Robotic Surgery
    • Robotic Surgical Procedures
    • Robotic Welding
    • Robotics Applications
    • Robotics Programming
    • Robotics Technologies
    • Robots Society and Ethics
    • Software and Hardware Designing for Robots
    • Spatial Transformations
    • Trajectory Generation
    • Unmanned (Robotic) Vehicles

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39050Nanosciences and Nanotechnologies: An International Journal (NIJ)Computer Science Journalscfp@cscjournals.org1288766930journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=NIJ
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: Nanosciences and Nanotechnologies: An International Journal (NIJ)
    Volume: 1 Issue: 1
    ISSN: 2180-1304
    URL: http://www.cscjournals.org/csc/description.php?JCode=NIJ

    About NIJ

    Nanotechnology has enormous potential to change society as it lead to new medical treatments and tools; more efficient energy production, storage and transmission; better access to clean water; more effective pollution reduction and prevention; and stronger, lighter materials.

    The Nanosciences and Nanotechnologies: An International Journal (NIJ) is a peer-reviewed journal with a wide-ranging coverage, consolidating research activities in all areas of nanoscience and nanotechnology into a single and unique reference source. With an open access policy, NIJ is the publishing high quality and original full research articles of important new scientific and technological findings, timely state-of-the-art reviews, current scientific research in the area relavant to nanoscience and nanotechnology.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for NIJ.

    NIJ List of Topics
    The realm of Nanosciences and Nanotechnologies: An International Journal (NIJ) extends, but not limited, to the following:

    • Atomic Manipulation
    • Computational Nanotechnology
    • Dendrimers
    • DNA Sequencing
    • Fullerenes
    • Green Nanotechnology
    • Molecular Assembler
    • Molecular Nanoscience
    • Molecular Nanotechnology
    • Nano-Optics
    • Nanobiotechnology
    • Nanocatalysis
    • Nanochips
    • Nanoclusters
    • Nanocomposites
    • Nanocrystalline
    • Nanoelectronics
    • Nanofabrication and Processing of Nanoscale Materi
    • Nanofluidics
    • Nanomachining
    • Nanomagnetism and Nanodevices
    • Nanomedicine
    • Nanomedicines Biomedical Nanotechnolog
    • Nanoparticles
    • Nanophysics
    • Nanoprobes
    • Nanorobotics
    • Nanorods
    • Nanoscale Genomics
    • Nanoscale Thin Films
    • Nanosensors and Nano-integration
    • Nanotechnology
    • Nanotechnology in Genetic Engineering
    • Nanotechnology in Molecular Engineering
    • Nanotechnology in Protein Engineering
    • Nanotechnology in Proteome
    • Nanotechnology in Structural Biology
    • Nanotribology
    • Nanotubes
    • Nanowire
    • Novel Applications of Nanostructured Materials
    • Properties of Nanoscale Materials
    • Quantum Dots
    • Quantum Wells
    • Quantum Wires
    • Structure Analysis at Atomic, Molecular, and Nanom
    • Superlattices
    • Supramolecules
    • Synthesis of Nanostructured and Nanoscale Material

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39051International Journal of Logic and Computation (IJLP)Computer Science Journalscfp@cscjournals.org1288767049journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJLP
    Important Dates
    Paper Submission: December 05, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Logic and Computation (IJLP)
    Volume: 1 Issue: 2
    ISSN: 2180-1290
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJLP

    About IJLP
    The International Journal of Logic and Computation aims to promote the growth of logic and computing research from the perspectives of logic, mathematics and computer science, but emphasizes semantics of programs, in contrast with the traditional treatment of formal languages as sets of strings. IJLP promote this new field with its comprehensive selection of technical scientific papers and regular contributions such as letters, reviews and discussions for logical systems using classical and non-classical logic, constructive logic, categorical logic, modal logic, type theory, logical issues in logic programming, knowledge-based systems and automated reasoning programing; logical programming issues in knowledge representation, non-monotonic reasoning, logics and semantics of programming and applications of logic in hardware and VLSI.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJLP.

    IJLP List of Topics
    The realm of International Journal of Logic and Computation (IJLP) extends, but not limited, to the following:

    • Architecture of imaging and vision systems
    • Autonomous vehicles
    • Character and handwritten text recognition
    • Chemical and spectral sensitization
    • Chemistry of photosensitive materials
    • Coating technologiesPhysics and chemistry of AgX
    • Coding and transmission
    • Cognitive aspects of image understanding
    • Color imaging
    • Communication of visual data
    • Data fusion from multiple sensor inputs
    • Display and printing
    • Document image understanding
    • Generation and display
    • Holography
    • Image analysis and interpretation
    • Image capturing
    • Image databases
    • Image generation
    • Image manipulation
    • Image permanence
    • Image processing
    • Image processing applications
    • Image processing: coding analysis and recognition
    • Image representation
    • Image sensing
    • Imaging systems and image scanning
    • Implementation and architectures
    • Latent image
    • Materials for electro-photography
    • Monitoring and surveillance
    • Network architecture for real-time video transport
    • New visual services over ATM/packet network
    • Non-impact printing technologies
    • Object modeling and knowledge acquisition
    • Photoconductors
    • Photographic emulsions
    • Photopolymers
    • Prepress and printing technologies
    • Processing and analysis
    • Protocols for packet video
    • Remote image sensing
    • Retrieval and multimedia
    • Scene modeling
    • Signal-processing aspects of image processing
    • Storage and transmission
    • Video coding algorithms and technologies for ATM/p
    • Visual inspection

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39052International Journal of Human Computer Interaction (IJHCI)Computer Science Journalscfp@cscjournals.org1288767188journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJHCI
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Human Computer Interaction (IJHCI)
    Volume: 1 Issue: 4
    ISSN: 2180-1347
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJHCI
    About IJHCI
    The International Journal of Human Computer Interaction (IJHCI) publishes original research over the whole spectrum of work relevant to the theory and practice of innovative and interactive systems. The journal is inherently interdisciplinary, covering research in computing, artificial intelligence, psychology, linguistics, communication, design, engineering, and social organization, which is relevant to the design, analysis, evaluation and application of human computer interactive systems.

    IJHCI addresses the cognitive, social, health, and ergonomic and other aspects of interactive computing including cognitive ergonomics, collaborative design, ergonomics & human factors, legal, ethical & social aspects of IT, human computer interaction, ergonomics, human computer interaction and user interface. IJHCI emphasizes the human element in relation to the systems in which humans function, operate, network, and communicate, including software, hardware, and their various contexts of use.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJHCI.

    IJHCI List of Topics
    The realm of International Journal of Human Computer Interaction (JHCI) extends, but not limited, to the following:
    • Agent models Co-ordination and communication
    • Agent-based Computing
    • Computer Mediated Communication
    • Computer Supported Cooperative Work
    • Design and Evaluation of Innovative Interactive Sy
    • Empirical Studies of User Behaviour
    • Graphic Interaction
    • Human language Technologies and Machine Learning i
    • Human-Computer Interaction Theory
    • Innovative Interaction Techniques
    • Intelligent Tutoring, Coaching and Debugging Syste
    • Intelligent user Interfaces
    • Interaction in Mobile and Embedded Systems
    • Interactive Decision Support Systems
    • Interface Design and Evaluation Methodologies
    • Knowledge Acquisition, Discovery, Modeling and Man
    • Mixed and Augmented Reality
    • Multimodal Interaction
    • Natural language interaction
    • Peer to Peer Communication Between Intelligent Sys
    • Presence
    • Speech Interaction
    • User Interface Prototyping for Interactive Systems
    • Virtual Reality

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39053Endangerment and Its ConsequencesMax Planck Institute for the History of Sciencevidal@mpiwg-berlin.mpg.de1288772321science_and_culturefull name / name of organization: Max Planck Institute for the History of Sciencecontact email: vidal@mpiwg-berlin.mpg.de

    Dates of workshop: 7-8 October 2011
    Deadline for submission: 15 February 2011
    Place: Max Planck Institute for the History of Science, Berlin, Germany

    The notion of endangerment stands at the heart of a network of concepts, values and practices dealing with a vast range of entities threatened by disappearance – from objects to organisms, to individual and collective identities, as well as to the durably material and fugitively psychological dimensions of entire cultures. Endangerment-thinking is bound up with devices, such as archives, catalogues or databases, aimed at preserving them or their traces. It thus opens the way for examining the construction of data deemed significant, the kind of knowledge such data constitutes, the structures into which it is organized, the affects that permeate it, and the moral and epistemic values it incarnates. Protecting the endangered and memorializing the extinct assume that the objects to be safeguarded or remembered are valuable; these are often associated with a supposedly natural or original state, sometimes, too with a condition of primeval authenticity. Architectural patrimony conserved in photographs, extinguished species in museum displays, or dead dialects in recordings nurture nostalgia for a more diverse world, and may give rise to resuscitation fantasies; together with dramatized depictions of imperiled places and organisms, they dynamize tensions between risk and heritage, and acquire political valence inside and outside science.

    The workshop aims at exploring the history and cultures of endangerment and its consequences in a broad geographical and chronological scope. Case studies combined with methodological and theoretical reflection may be the approach best adapted for that purpose.

    We shall pursue such questions as: - How have traces or remnants been legitimized as representatives of extinct objects? - What concepts, technologies, and social forms have made it possible to interpret a taxidermized body as a "species," or a grammar and a dictionary as a "language"? – When, and in what contexts did the notion of "endangerment" emerge, and how can we periodize the discourse of endangerment? - What is the relation between the imagined past of an object threatened with extinction and the imagined futures in which its preservation will be valued? - Which affects and values animate the sciences of endangerment, and how do they contribute to give shape to modes of knowledge-production?

    Language of the workshop: English

    Please send a 500-word proposal by 15 February 2010 to Fernando Vidal, vidal@mpiwg-berlin.mpg.de

    The Max Planck Institute for the History of Science will cover travel and accommodation.

    The workshop is organized in the framework of the project "The Sciences of the Archives," http://www.mpiwg-berlin.mpg.de/en/research/projects/DeptII_Daston-Scienc....

    cfp categories: science_and_culture 39054Journal of Sonic StudiesMarcel Cobussen, Leiden University and Vincent Meelberg, Radboud University Nijmegenv.meelberg@let.ru.nl OR M.A.Cobussen@umail.leidenuniv.nl1288778568cultural_studies_and_historical_approachesecocriticism_and_environmental_studiesinterdisciplinaryjournals_and_collections_of_essayspopular_culturetheorytwentieth_century_and_beyondfull name / name of organization: Marcel Cobussen, Leiden University and Vincent Meelberg, Radboud University Nijmegencontact email: v.meelberg@let.ru.nl OR M.A.Cobussen@umail.leidenuniv.nl

    Call for Papers

    We are pleased to announce the launch of the online Journal of Sonic Studies, a new international peer-reviewed journal on auditory culture. Sonic studies covers both the material production and consumption of sound (including music, noise and "silence") and the cultural meaning of sound (e.g. through listening). It explores the dynamic interaction between the physical environment, the socio-cultural milieu, the producer(s) of sounds, such as musicians, sound engineers, sound artists, producers, as well as the individual listener. In short: sonic studies focus both on the production, the distribution, and the reception of sound.

    With the biannual, peer reviewed online Journal of Sonic Studies we intend to provide a platform for those theorists and artists who would like to discuss these, as well as other relevant, issues regarding auditory culture. Although we explicitly invite both theorists and artists to contribute, we expect all contributions to have a firm theoretical grounding. Our editorial board, which includes artists/scholars such as Francesco López, Stephen Vitiello, Brandon LaBelle, Aden Evens, and Jean-Paul Thibaud will be a guarantee for this.

    The primary aim of the journal is to think through and problematize auditory culture, in order to understand the impact and importance of sound for our culture and to expose possible misconceptions of certain aspects of sound and the way people, both listeners and producers, deal with and value sound. Also, since it is an online journal, we stimulate authors to make use of the extended possibilities that such a journal offers as opposed to traditional, paper-based publications. Consequently, we encourage contributors to include sound files, hypertexts, audio-visual material, etc.

    For the first issue of the Journal of Sonic Studies we invite theorists and artists to submit a proposal for an article, or complete articles, on a particular aspect of auditory culture. Possible topics may include, but are not limited to, the history of auditory culture, the ontology of sound, the epistemology of sonic studies, the possible (interdisciplinary) approaches to productively study auditory culture, and the specificity of sonic studies.

    An abstract of 800 words, or complete articles, should be sent by e-mail to v.meelberg@let.ru.nl or M.A.Cobussen@umail.leidenuniv.nl no later than January 31, 2011.

    The editors of the Journal of Sonic Studies: Marcel Cobussen and Vincent Meelberg.

    cfp categories: cultural_studies_and_historical_approachesecocriticism_and_environmental_studiesinterdisciplinaryjournals_and_collections_of_essayspopular_culturetheorytwentieth_century_and_beyond 39055Chris Colfer Preps Up for a Duet With his New Love InterestRockksrockks345@gmail.com1288783544film_and_televisionfull name / name of organization: Rockkscontact email: rockks345@gmail.com

    Hello Glee fanatics! How are you all doing?

    I know you were just waiting for me to get you the latest buzz about your favorite comedy show. So, here I am with the news that actor Chris Colfer is likely to be seen performing a duet with his new love interest, in one of the Glee episodes.

    Chris Colfer

    According to the sources close to development, Kurt Hummel (Chris Colfer) will perform a duet in the Christmas special episode of the show. You must be thinking that there is still a lot of time for the year's biggest festival to arrive, and the special episode will air during that time only.

    But have you ever thought why the news has been announced so early? It's because Glee Christmas album will hit the stands in the month of November. So, be prepared to get a copy of the new album.

    However, if you want to find what has happened so far, then catch Glee season 2 on this reliable online destination.

    The award-winning show is already on the top for bringing all kinds of excitement. And with the announcement of the Christmas special episode, it has multiplied the fans' expectation.

    I guess everybody must be aware that Kurt gave a gay angle to the storyline in the first season of the show. And his crush on Finn Hudson (Cory Monteith) was the centre of attraction. If you wish to recall that moment, then grab a Glee download from here.

    Well, well, well! Who will be Kurt's love interest this time around? Must be from among the members of the Glee Club!

    So, in my opinion, you shouldn't miss the upcoming excitement. In case you fail to watch it on air, then enjoy Glee online from this unique website.

    Since the show has the tendency to surprise, be prepared to witness the unexpected in the Christmas special episode. I am sure there is something in the minds of the writers of Glee TV show, which will leave us wondering for many years.

    I guess that's why the show managed to capture the imagination of millions of people, within a jiffy.

    So, until the next update, keeping watching the new season of the most sought-after musical comedy drama, Glee!

    cfp categories: film_and_television 39056Chris Colfer Preps Up for a Duet With his New Love InterestRockksrockks345@gmail.com1288783777film_and_televisionfull name / name of organization: Rockkscontact email: rockks345@gmail.com

    Hello Glee fanatics! How are you all doing?

    I know you were just waiting for me to get you the latest buzz about your favorite comedy show. So, here I am with the news that actor Chris Colfer is likely to be seen performing a duet with his new love interest, in one of the Glee episodes.

    Chris Colfer

    According to the sources close to development, Kurt Hummel (Chris Colfer) will perform a duet in the Christmas special episode of the show. You must be thinking that there is still a lot of time for the year's biggest festival to arrive, and the special episode will air during that time only.

    But have you ever thought why the news has been announced so early? It's because Glee Christmas album will hit the stands in the month of November. So, be prepared to get a copy of the new album.

    However, if you want to find what has happened so far, then catch Glee season 2 on this reliable online destination.

    The award-winning show is already on the top for bringing all kinds of excitement. And with the announcement of the Christmas special episode, it has multiplied the fans' expectation.

    I guess everybody must be aware that Kurt gave a gay angle to the storyline in the first season of the show. And his crush on Finn Hudson (Cory Monteith) was the centre of attraction. If you wish to recall that moment, then grab a Glee download from here.

    Well, well, well! Who will be Kurt's love interest this time around? Must be from among the members of the Glee Club!

    So, in my opinion, you shouldn't miss the upcoming excitement. In case you fail to watch it on air, then enjoy Glee online from this unique website.

    Since the show has the tendency to surprise, be prepared to witness the unexpected in the Christmas special episode. I am sure there is something in the minds of the writers of Glee TV show, which will leave us wondering for many years.

    I guess that's why the show managed to capture the imagination of millions of people, within a jiffy.

    So, until the next update, keeping watching the new season of the most sought-after musical comedy drama, Glee!

    cfp categories: film_and_television 39057Second Annual Graduate and Undergraduate Student Conference on Literature, Composition, and Rhetoric, April 1st and 2ndUniversity of Tennessee at Chattanooga and Sigma Tau Delta - Xi Alpha chapterUniversity of Tennessee at Chattanooga and Sigma Tau Delta - Xi Alpha chapter1288793032african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryjournals_and_collections_of_essaysmedievalmodernist studiespoetrypopular_culturepostcolonialreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytwentieth_century_and_beyondvictorianfull name / name of organization: University of Tennessee at Chattanooga and Sigma Tau Delta - Xi Alpha chaptercontact email: University of Tennessee at Chattanooga and Sigma Tau Delta - Xi Alpha chapter

    We are welcoming graduate and undergraduate student papers or full panel proposals that address any area of literature (British, American, world, colonial and post-colonial, medieval, modern, contemporary, etc.), rhetoric, composition, or pedagogical studies. Please submit a 250-300 word abstract to xialpha.utc.conference@gmail.com. Submissions must include name, institutional affiliation, student status (graduate or undergraduate), contact information (name, phone number, address, email address), and a list of any audio/visual equipment needed for your presentation. Presentation time should be limited to 20 minutes (usually about ten pages). Abstracts should be received by January 30, 2009.

    cfp categories: african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryjournals_and_collections_of_essaysmedievalmodernist studiespoetrypopular_culturepostcolonialreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytwentieth_century_and_beyondvictorian 39058Second Annual Graduate and Undergraduate Student Conference on Literature, Composition, and Rhetoric April 1st-2ndUniversity of Tennessee at Chattanooga and Sigma Tau Delta - Xi Alpha chapterXialpha.utc.conference@gmail.com1288793380african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsgraduate_conferenceshumanities_computing_and_the_internetinterdisciplinarymedievalmodernist studiespoetrypopular_culturepostcolonialreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorianfull name / name of organization: University of Tennessee at Chattanooga and Sigma Tau Delta - Xi Alpha chaptercontact email: Xialpha.utc.conference@gmail.com

    We are welcoming graduate and undergraduate student papers or full panel proposals that address any area of literature (British, American, world, colonial and post-colonial, medieval, modern, contemporary, etc.), rhetoric, composition, or pedagogical studies. Please submit a 250-300 word abstract to xialpha.utc.conference@gmail.com. Submissions must include name, institutional affiliation, student status (graduate or undergraduate), contact information (name, phone number, address, email address), and a list of any audio/visual equipment needed for your presentation. Presentation time should be limited to 20 minutes (usually about ten pages). Abstracts should be received by January 30, 2010.

    cfp categories: african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsgraduate_conferenceshumanities_computing_and_the_internetinterdisciplinarymedievalmodernist studiespoetrypopular_culturepostcolonialreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorian 39059[UPDATE] CFP: Supernatural Panel, SF&F Area, SW/TX PCA/ACA 2011Jennifer Love & Lugene Rosen / Southwest Texas PCA/ACAjennelizlove@gmail.com, lumarose@aol.com1288798102film_and_televisiongender_studies_and_sexualitypopular_culturereligiontwentieth_century_and_beyondfull name / name of organization: Jennifer Love & Lugene Rosen / Southwest Texas PCA/ACAcontact email: jennelizlove@gmail.com, lumarose@aol.com

    UPDATE: This CFP has been CLOSED/REMOVED. SW/TX PCA ACA Science Fiction and Fantasy section has a comprehensive CFP for Supernatural papers here: http://call-for-papers.sas.upenn.edu/node/38357

    Please consider submitting to the SW/TX PCA ACA SFF folks -- they run great panels and will no doubt have a fabulous collection of presentations in this area.

    In Supernatural's season 5 episode "The Real Ghostbusters," Eric Kripke started us off with "Frightened Little Boy: The secret life of Dean Winchester" and "Homo-erotic subtext of Supernatural." If you're anything like us, that line of dialogue offered a clear, albeit sardonic, invitation to write and share some of those analyses that are begging to be explored. Over five seasons, we've seen this intriguing show take on issues of family, religion, good versus evil, destiny versus free will, what it means to be human, and other subjects rife with complication and ready for analysis and interpretation.

    Join us in a panel that addresses any aspect of the television show Supernatural. We are looking for papers that offer critical and intellectual engagement with the subject. The topics and approaches are not limited. We ask only that you focus your analysis on Supernatural—episode, season, character, story arc, film making, fandom, how the show speaks to today's world, etc.—and that you take a scholarly approach.

    For more information on the conference, please visit the Southwest/Texas Popular Culture/American Culture Association: http://www.swtxpca.org.

    cfp categories: film_and_televisiongender_studies_and_sexualitypopular_culturereligiontwentieth_century_and_beyond 39060[UPDATE] Jesters and Gestures: Irony at a CrossroadsThe City University of New York Graduate Center Department of Comparative Literatureironyconference2011@gmail.com1288800325african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsgraduate_conferencesinterdisciplinaryinternational_conferencesmedievalmodernist studiespoetrypopular_culturepostcolonialreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorianfull name / name of organization: The City University of New York Graduate Center Department of Comparative Literaturecontact email: ironyconference2011@gmail.com

    Jesters and Gestures: Irony at a Crossroads
    February 24-25, 2011
    Abstract Deadline: December 1st, 2010

    Keynote Speaker: Claire Colebrook, Penn State

    "The ironization of form is like the storm which lifts up the curtain of the transcendental order of art and reveals it for what it is, in this order as well as in the unmediated existence of the work."
    -Walter Benjamin, The Concept of Art Criticism in German Romanticism

    "The irony of the novel is the self-correction of the world's fragility"
    -Georg Lukacs, The Theory of the Novel

    This year's conference proceeds from the assumption that it is irony's very indeterminability that makes a central consideration in every act of interpretation. Because of this, acts of interpretation necessarily reflect the anxiety burrowed between understanding and misunderstanding, and meaning remains unsettled. The power of irony is that it skirts meaning, says what it does not mean, and means what it cannot exactly say. As a result, irony remains an illusive and adumbrated literary trope that requires an uneasy acknowledgement that "something" is going on that does not have clear definitions, limits, or guidelines.

    We invite papers from all disciplines that focus on works from any period that explore the way irony functions as a trope in art, literature, film, or society. Some questions we seek to address include, but are in no way limited to:

    -How does irony as rhetoric, trope, technique, and hermeneutic serve as the mirror-image of a world out of joint?
    -Does irony as a self-reflective literary mode necessarily place all subjectivity, autonomy, and self into question?
    -What role do ironic characters play in literature, film, or art?
    -How does irony explore the representational limits of language?
    -How does the definition of irony change throughout history or between cultures?
    -Does irony as a technique that constantly reminds us of our linguistic contingency serve as a form of ideological critique, and post-universalist, post-metphysical aesthetics?
    -How does the dialectical movement of irony question the ontological status of literature and the arts?
    -What role does irony play in the much overlooked humor of the modernist period?
    -What is the relationship between irony and other literary techniques, including but not limited to humor?

    Please submit a 300 word abstract for a 15-20 minute paper by December 1st, 2010 to ironyconference2011@gmail.com. Proposals should include the title of the paper, presenter's name, institutional and departmental affiliation, and any technology requests. We also welcome panel proposals of three to four papers.

    This conference is co-sponsored by the Writers' Institute at the City University of New York Graduate Center, an un-MFA program devoted to bringing together the country's most talented writers and today's most celebrated editors, and by the Center for the Humanities, an interdisciplinary public forum devoted to promoting the humanities programs both for CUNY students and for all New Yorkers.

    cfp categories: african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsgraduate_conferencesinterdisciplinaryinternational_conferencesmedievalmodernist studiespoetrypopular_culturepostcolonialreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorian 39061'Round and 'Round We Go: The Endless Carnival, Philadelphia, P.A. (2/25/2011)Department of Germanic Languages and Literatures, University of Pennsylvaniapenncarnival@gmail.com1288806048african-americanamericanchildrens_literatureclassical_studiescultural_studies_and_historical_approacheseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygraduate_conferencesinterdisciplinarymedievalmodernist studiespoetrypopular_culturepostcolonialreligionrenaissanceromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorianfull name / name of organization: Department of Germanic Languages and Literatures, University of Pennsylvaniacontact email: penncarnival@gmail.com

    'Round and 'Round We Go: The Endless Carnival
    The Department of Germanic Languages and Literatures at the University of Pennsylvania
    Friday, February 25, 2011
    Keynote Speaker: Prof. Katrin Sieg, Associate Professor of German at Georgetown University's BMW Center for German & European Studies

    "The feast is a primary, indestructible ingredient of human civilization; it may become sterile and even degenerate, but it cannot vanish."
    ~Mikhail Bakhtin, Rabelais and His World

    The festival of Carnival is perhaps most exciting for its paradoxical nature. The unallowable is, for a time, allowed; the status quo tossed aside so that it may endure more stably during the rest of the year. Yet, perhaps inevitably, Carnival oversteps its temporal restrictions and becomes timeless. From the disorder central to the Fastnachtspiele of the 15th and 16th centuries to the subversive pageantry of present-day drag balls such as those featured in Jennie Livingston's film Paris is Burning (1990), the topsy-turvy world knows no chronological or geographic limits.

    By putting the "-esque" in Carnival and asserting that the feast "cannot vanish," Mikhail Bakhtin significantly calls our attention to the ways in which Carnival slips its leash. His vital "-esque" indicates that there are many manners in which the Carnival persists long after its season is over. Is it more accurate to say that Carnival is endlessly recurring, or that it never truly ends in the first place? What are the ways and manners in which Carnival continues?

    It is the longevity of the Carnival paradox that is at the heart of this conference. We are devoted to exploring the enduring ethos of the topsy-turvy. Possible themes for papers include (but are not limited to) the concept of the carnivalesque and its:

    · Ambivalent figures, such as the jester, the holy fool, and the devil
    · Possible afterlife and continuation
    · Closure and/or limitations
    · Links to religious or antique feasts
    · Humorous and/or violent expressions
    · Regional, national, or transnational incarnations
    · Possible utilization for political and social change
    · Portrayals across various media (paintings, novels, film, graphic novels, etc.)
    · Performance/Performativity
    · Expression in contemporary LGBTQ culture(s)
    · Post-Bakhtinian theorization

    Deadline for Abstracts: December 22, 2010.

    Please send an anonymous abstract (max. 500 words) with a separate cover sheet indicating the author's name, affiliation, address, and e-mail address to penncarnival@gmail.com.

    cfp categories: african-americanamericanchildrens_literatureclassical_studiescultural_studies_and_historical_approacheseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygraduate_conferencesinterdisciplinarymedievalmodernist studiespoetrypopular_culturepostcolonialreligionrenaissanceromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorian 39062Paper proposals on TELEVISION due Dec 15, 2010 for conference meeting April 20-23, 2011PCA/ACA & Southwest/Texas Popular Culture and American Culture mganas@apu.edu1288806273americancultural_studies_and_historical_approachesethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsinterdisciplinarypopular_culturetwentieth_century_and_beyondfull name / name of organization: PCA/ACA & Southwest/Texas Popular Culture and American Culture contact email: mganas@apu.edu

    Call for Papers: Television
    PCA/ACA & Southwest/Texas Popular Culture and American Culture Associations Joint Conference
    April 20-23, 2011
    San Antonio, TX
    http://www.swtxpca.org
    Abstract or Panel Proposal submission deadline: December 15, 2010
    Conference hotel: Marriott Rivercenter San Antonio
    101 Bowie Street, San Antonio, Texas 78205 USA
    Hotel Phone: 1-210-223-1000

    The Southwest/Texas Popular Culture and American Culture Associations' annual conference is one of the nation's largest gatherings of interdisciplinary scholars. The 32nd annual SW/TX PCA/ACA conference will take place jointly with the PCA/ACA national conference, occurring April 20-23, 2011, at the Marriott Rivercenter in vibrant San Antonio (just steps from the popular Riverwalk). Further conference details are available at http://www.swtxpca.org . Panels are now forming for all of the SW/TX PCA/ACA 80+ individual subject areas, including the Television area.

    The Television Area Chair invites interested scholars to submit papers on any aspect of television (current and past shows, content, television as a media format, the possible future of television, television effects or cultural impact, television and society, television and gender, television and ethnicity, television artifacts and rituals, theories and criticism of television, the television business, etc.)

    Scholars, teachers, professionals, and others interested in television are encouraged to participate. Graduate students are also particularly welcome with award opportunities for best graduate papers. If you wish to form your own television-focused panel, I would be glad to facilitate your needs. Send 100-200 word abstract or panel proposal with names of all participants by Dec 15.

    Monica Ganas
    Television Area Chair
    Azusa Pacific University
    mganas@apu.edu
    (626) 815-5460

    cfp categories: americancultural_studies_and_historical_approachesethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsinterdisciplinarypopular_culturetwentieth_century_and_beyond 39063Small Cinemas in Transition: Small, Smaller, Smallest. September 16-18, 2011Bennet Schaber/SUNY Oswegoschaber@oswego.edu1288808929ethnicity_and_national_identityfilm_and_televisionhumanities_computing_and_the_internetinterdisciplinaryinternational_conferencesfull name / name of organization: Bennet Schaber/SUNY Oswegocontact email: schaber@oswego.edu

    Call For Papers

    Small Cinemas in Transition: Small, Smaller, Smallest.

    September 16-18, 2011.

    State University of New York, Oswego

    The second annual international conference, Small Cinemas in Transition, brings together film scholars and students to discuss the emergences and disappearances, stabilizations and transformations, of "small cinemas" worldwide. The conference organizers understand the notion of "small cinemas" to be fluid and plural, linking discursively and politically: the cinemas of small nation-states to the "postage stamp" cinemas of mobile devices (or Edison's nickelodeon); the cinemas of ethnic and religious minorities to the cinemas of minors and so-called "minor" cinemas; the cinemas of closed communities to the cinemas of international struggle and resistance. In short, "small cinemas" names the ongoing exigency of thinking the aesthetic, economic, ethical and political assertions of various and variable collectives under the conditions of global capitalism. And not unambiguously, "small cinemas" names one of the crucial fronts in the ongoing assertions and expositions of, and struggles for, common being and being in common.
    www.oswego.edu/smallcinemas

    Organizers:

    Prof. Rodica Ieta (English and Creative Writing)
    Prof. Lenuta Giukin (Modern Languages)
    Prof. Bennet Schaber (Cinema and Screen Studies)

    Plenary Speakers:

    TBA

    Presentations are invited on any aspect of "small cinemas," to be arranged under the following headings:

    Theorizing Small Cinemas
    • Globalization and Miniaturization
    • Centers and Peripheries
    • Majorities and Minorities
    • Sedentary and Migratory
    • Communal, Regional, National, Supra-national
    • Racial, Ethnic, Universal

    Aesthetics of Small Cinemas
    • New Waves
    • New Auteurisms
    • New Technologies
    • Image, Sound, Silence
    • Language and Writing
    • Interactivity and Functionality
    • Archives and Ephemera

    Economies and Scales
    • Forces, Means and Relations of Production
    • Distribution, Transmission, Diffusion
    • Festivals and Financing
    • Formatting
    • Property, Propriety and Impropriety
    • Memory, Forgetting, Storage

    Send by April 1st 2011 abstract (no more than 350 words) and short bio for paper proposals (no more than 20 minutes) or panels (three presentations) as attached PDF or Word document to:

    lenuta.giukin@oswego.edu
    rodica.ieta@gmail.com
    bennet.schaber@oswego.edu

    cfp categories: ethnicity_and_national_identityfilm_and_televisionhumanities_computing_and_the_internetinterdisciplinaryinternational_conferences 39064PCA/ACA: LATIN AMERICANS & LATINOS - IDENTITY ISSUES & CULTURAL STEREOTYPES (San Antonio, TX, Apr 20-23. 2011)Popular Culture Association / American Culture Associationrrosales@drew.edu1288815294cultural_studies_and_historical_approachesethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualityinterdisciplinarypopular_culturetheatretwentieth_century_and_beyondfull name / name of organization: Popular Culture Association / American Culture Associationcontact email: rrosales@drew.edu

    Popular Culture Association/American Culture Association (PCA/ACA) National Conference

    April 20-23, 2011

    San Antonio, Texas
    Marriott Rivercenter and Riverwalk Hotels

    Subject Area: Latin Americans & Latinos - Identity Issues & Cultural Stereotypes

    Proposals are welcome as they relate to concrete issues of identity and/or stereotyping within Latin American and Latino contexts, including but not limited to notions of gender, sexuality, language, race/ethnicity, nationality, politics, immigration, and customs or traditions. Papers may focus on questions of identity and stereotyping in literary, cinematographic, theatrical, media, sociological or other popular culture frameworks within Latin American and Latino contexts in the U.S. or abroad. All disciplines and theoretical approaches considered. Papers may be presented in English or Spanish. Three-person panel proposals are strongly encouraged. Each participant will have approximately 20 minutes for his/her presentation.

    Please e-mail an abstract of 100-150 words no later than December 15, 2010 to:

    Raúl Rosales Herrera, PCA Area Chair
    Drew University
    rrosales@drew.edu

    For more information about the conference or San Antonio, please visit: www.pcaaca.org

    cfp categories: cultural_studies_and_historical_approachesethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualityinterdisciplinarypopular_culturetheatretwentieth_century_and_beyond 39065Call for Chapter ProposalsMatthew Lynchlynch39083@aol.com1288815542african-americanamericanethnicity_and_national_identityfull name / name of organization: Matthew Lynchcontact email: lynch39083@aol.com

    Praeger will be publishing a two-volume series entitled, Before Obama: A Reappraisal of Black Reconstruction Era Politicians. We are now looking for contributors for this two-volume set. For consideration, send a letter to the editor, Dr. Matthew Lynch lynch39083@ao1.com, expressing interest and requesting a list of available politicians. For further consideration, applicants are be required to submit a750-word proposal by January 10th, 2011 Chapters of 6,500-7,000 words will be due by May 1st, 2011.

    Black Reconstruction Era Politicians

    Blanche Kelso Bruce, Richard Harvey Cain, Robert Brown Elliott, Tunis Campbell, Henry Cheatham, Robert Carlos De Large, Oscar James Dunn, Robert B. Elliott, Jeremiah Haralson, John Adams Hyman, John Mercer Langston, Jefferson Franklin Long, Jonathan Clarkson Gibbs, Mifflin Wistar Gibbs, John Roy Lynch, Samuel A. McElwee, Robert Meacham, John Willis Menard, Thomas Ezekiel Miller, George Washington Murray, Charles Edmund Nash, James Edward OHara, P.B.S. Pinchback, Joseph Hayne Rainey, Alonzo Jacob Ransier, James Thomas Rapier, Hiram Rhodes Revels, Robert Smalls, Benjamin Sterling Turner, Alexander Twilight, Josiah Thomas Walls, George Henry White

    Short Description

    This multi volume set examines the leadership and contributions of black politicians during the Reconstruction era. Between 1865 and 1876, about two thousand blacks held elective and appointive offices in the South but these men faced astounding odds. They were belittled as corrupt and inadequate by their white political opponents, who used legislative trickery, libel, bribery, and brutal intimidation of their constituents to rob these black lawmakers of their base of support. A few, such as the senator from Mississippi Blanche K. Bruce, are well known, but most have languished in obscurity, omitted from official state histories. In addition, when they have been profiled by modern historians they're used as scapegoats for the utter disaster that was Reconstruction. These biographical sketches profile diverse men whose Reconstruction efforts should not be overlooked.

    Approach

    This multivolume set will provide an intimate look at black Reconstruction era politicians, spotlighting their leadership and contributions during the Reconstruction era and illuminating how they fostered the development of a parallel civil society within black communities. In addition, it will also explain how their contributions set the stage for the Civil Rights movement and the world as we know it today. It will also explore the idea that if theses brave souls had not found the courage to stand, the election of Barack Obama would not be possible at this juncture in history.

    By examining each politician on a case-by-case basis, pointing out what contributions he made, what changes he encouraged, and ways that he set the stage for the future, as well as what may have gone wrong during his term in office, why history has judged him the way it has, and what accepted but often incorrect myths that surround each politician, this book will introduce theories that will allow historians and layman alike to reappraise this era of purported "Negro Misrule." These theories will also explain why these black congressmen have languished in obscurity. Also notable is the fact that these politicians have been ignored by most of the history textbooks by the publishing industries at the behest of the curriculum of America's schools. This book will provide an avenue and framework for the introduction of these men to the nation. With the election of President Obama, America would embrace the opportunity to receive background information on the men who laid the ground work for the election of future black legislators after the Civil Rights movement and consequently President Obama.

    Project Timetable
    Tentative timetable for the entire project
    January 10th: Deadline for submission of 750-word proposal
    February 1st: Selected contributors will be informed
    February 7th: Submission instructions sent to Authors
    May 1st: Chapter submitted by Contributors on or before this date
    May 1st: Each chapter sent to Reviewers 1 and 2
    May 21st: Each chapter received back from Reviewer 1 and 2
    May 25th: Authors notified of revisions (if applicable)
    June 14: Revised chapters submitted by Contributors on or before this date
    June 30th: Authors notified of decision and further revisions
    July 10th: Final chapters received from Authors
    July 30th: Final chapters edited
    August 30th: Manuscript edited and delivered to publisher

    Editor contact details:
    Matthew Lynch, Ed. D.
    Assistant Professor of Education
    Widener University
    601.630.5238- cell
    610.499.4285- office
    lynch39083@aol.com
    mlynch@mail.widener.edu

    cfp categories: african-americanamericanethnicity_and_national_identity 39066D. H. Lawrence: Colonial, Modernist and Postcolonial Perspectives, June 29 –July 2, 2011 Sydney, AustraliaDr. Nancy L. Paxton, Conference Organizer; D. H. Lawrence Society of North Americanlpaxton@gmail.com1288815983ecocriticism_and_environmental_studiesgender_studies_and_sexualitymodernist studiespostcolonialtwentieth_century_and_beyondfull name / name of organization: Dr. Nancy L. Paxton, Conference Organizer; D. H. Lawrence Society of North Americacontact email: nlpaxton@gmail.com

    The D. H. Lawrence Society of North America invites you to attend the 12th international conference in Sydney, Australia, June 29-July 3, 2011. Conference organizers invite established and emerging scholars interested in all genres of Lawrence's writing, biography, or experience of Australia to join with specialists concerned with his reception by Australian modernists or his influence on more recent post-colonial writers, composers, artists and filmmakers in Australia and around the world. While conference organizers will consider individual papers that address other aspects of Lawrence's writing, they invite panels and papers on the following topics:

    o Lawrence and modernist or postcolonial writing from around the world, including Lawrence's response to modernism; responses to his work by post-modernist and post-colonial writers in the past or present;
    o Lawrence and Australian Modernists, including Patrick White, Christina Stead, Eleanor Dark, and others;
    o Lawrence and Australian women writers; including Katharine Susannah Prichard, Miles Franklin, Henry Handel Richardson, Christina Stead, Eleanor Dark, Jean Devanny, Judith Wright, Elizabeth Jolley, and others;
    o Lawrence and indigenous Australians;
    o Lawrence and music: including music in Lawrence's novels and poetry; musical works inspired by Lawrence's poetry, prose, or art;
    o Lawrence and the visual arts: including Lawrence and aesthetics; Lawrence's paintings; art works inspired by Lawrence, including work by Norman Lindsay and others;
    o Lawrence and film: including film adaptations of Kangaroo, The Boy in the Bush, Sons and Lovers, The Rainbow, Women in Love, Lady Chatterley's Lover, Rocking Horse Winner;
    o Lawrence and twentieth-century thought, including psychoanalysis, modernist aesthetics, existentialism, fascism, nationalism, race, etc.;
    o Lawrence's literary reception in Australia and around the world, including censorship of his works;
    o Lawrence on the environment: including responses to industrialism; his representations of rural life; his critique of rural development;
    o Lawrence on sex/gender: including representations of male and female gender identities, sexuality, and/or queer identity; representations of sexuality and national identity; sexuality and transformation; sexuality and race;
    o Lawrence and feminism: including modernist, post-modernist, and contemporary responses, including Katherine Mansfield, H. D., Anäis Nin, Rebecca West, Kate Millett, and others;
    o Lawrence's poetry; including influences on contemporary poetry.

    Keynote addresses, plenary sessions, concurrent panels, and films will be offered at the Mitchell Library, Macquarie Street, in the heart of Sydney. A welcome reception and the awards dinner will be held at the Menzies Hotel, 14 Carrington Street, a short walk from the Mitchell Library. The Menzies Hotel will offer conference participants excellent discounted rates for accommodations. Conference participants are responsible for making their own room bookings directly with the hotel.

    The program committee includes representatives from the D. H. Lawrence Society of North America, the D. H. Lawrence Society of Australia, the D. H. Lawrence Society of Japan, the director of the D. H. Lawrence Research Center at the University of Nottingham, and eminent Lawrence scholars from around the world. The committee will review abstracts and notify participants about papers and panels accepted for presentation by Feb. 1, 2011. Details about keynote speakers, related events, and the excursions to Manly, Taronga Zoo, and Thirroul will be announced soon. For further information, conference registration, hotel accommodations, and membership in the DHLSNA, visit our website: http://dhlsna.com. Conference information will also be posted on the DHLSNA page on Facebook.

    Please send abstracts of 250 words for papers or proposals for panels of three presenters in electronic files (in PDF or Word 2003) along with full contact details to the Conference Director, Dr. Nancy L. Paxton: nlpaxton60@gmail.com by December 1, 2010.

    cfp categories: ecocriticism_and_environmental_studiesgender_studies_and_sexualitymodernist studiespostcolonialtwentieth_century_and_beyond 39067In the Mirror of the Past: Journeys from History to HISTORY - Int. Conference on the Fantastic and the Miraculous May 9-10, 2011Center for Mythopoeia and Philosophy of Literature at the University of Zielona Góra, Polandaleksander.rzyman@xl.wp.pl1288822011interdisciplinaryinternational_conferencesfull name / name of organization: Center for Mythopoeia and Philosophy of Literature at the University of Zielona Góra, Polandcontact email: aleksander.rzyman@xl.wp.pl

    Co-sponsored by Center for Mythopoeia and Philosophy of Literature and Center for
    Advanced Studies in Popular Literature at the Department of Polish, as well as by Center for
    Francophone Literature and Culture at the Department of Modern Languages, the three-day
    FANCUD conference at the University of Zielona Góra, Poland, is the only annual conference
    in the country on the literary and filmic intersections of myth, fantasy, science fiction and
    other speculative genres.

    The focus will be on the theme of restorative journeys from linear, isolated,
    and meaningless history to HISTORY that is meaningful through participation in a reality that
    transcends it. One increasingly pronounced element of contemporary life is the experience of
    helplessness in the face of overwhelming events and processes. Trying to make sense of the
    world and of their own identity, modern people often re-enact, albeit without realizing it,
    mythic patterns embedded in their cultures. The extent to which those patterns continue to be
    relevant tools for modern circumstances is a matter of considerable dispute. The Conference will
    seek to examine the presence in modern literature and culture of one such mythic pattern: the
    pull toward "eternal return," as Mircea Eliade put it, from meaningless history to HISTORY
    in which events are transformed into archetypal categories.

    Confirmed speakers include Prof. Brian Attebery (Idaho State University), Prof. Véronique
    Gély (the Sorbonne, Paris), Prof. Papa Samba Diop (the Sorbonne, Paris) Prof. Auguste Owono-Kouma (University of Yaounde,
    Cameroon), Prof. Jakub Z. Lichański (University of Warsaw), Prof. Marek Oziewicz(University of Wrocław).

    We encourage papers, panels and presentations on literary, political, theological, linguistic,
    cultural and social aspects of journeys from history to HISTORY. We also welcome papers on
    other aspects of the anti-historical tradition. Topics may include but are not limited to the
    following:
    • The search for one's own history,
    • HISTORY as the research arena for one's own history,
    • The crisis of the historical awareness,
    • Unity of time in traditional cultures,
    • Mythic dimension of time in mass culture,
    • The archaic dimension of HISTORY,
    • Sacred time in religions and beliefs,
    • The past as the philosopher's questioning grounds,
    • Time in utopia,
    • Time in folklore and folk traditions,
    • Prayer time as reading and ritual,
    • Futurological games played with history,
    • Mythologemes in literature as vehicles for HISTORY,
    • Representations of history in fantasy and science-fiction,
    • Medievalism and the pull of the past in speculative literature,
    • Cultural images of time,
    • Modern interest in myth and its meanings,
    • Cultural transmission of myth.

    The deadline for submission of proposals is February 15, 2011, although earlier submissions
    are encouraged. Please send a 250-350 word proposals to the Conference Secretary,
    Agnieszka Ryzza-Woźniak, at:

    Agnieszka Ryzza-Woźniak
    Department of Polish
    The University of Zielona Góra
    al. Wojska Polskiego 67
    65-677 Zielona Góra
    Poland, United Europe

    You can also e-mail submissions to a_ryzza@o2.pl (please put "FANCUD submission" in the
    subject line) or to appropriate Division Heads (listed below). Proposals must be accompanied
    by completed Registration Forms.

    As you submit your proposal, please indicate if you have any scheduling restrictions,
    audiovisual needs (OHP, DVD/VHS player), special needs, or a need for a written letter of
    acceptance of your proposal. For information about registration, travel or accommodations,
    for assistance or disabilities issues, please contact the Conference Secretary. For more
    information and conference updates go to fancud@ifp.uz.zgora.pl

    Notifications of acceptance will be sent electronically by February 28, 2011.
    By March 15, 2011, accepted presenters will have to send in précis of their presentations and
    also pay the €150 Conference Registration Fee.

    The précis must be a 500 to 800-word abstraction of the central informing idea of the article
    and a cogent presentation of the development of its argument. It must be something more than
    an extended abstract; the précis for English, Russian, German, and French presentations will
    be translated into Polish and made available to conference participants as handouts.
    The conference fee payment must be made by bank transfer to the
    University of Zielona Góra account as specified below:
    SWIFT/BIC code: KRDBPLPW
    Bank name: Kredyt Bank S.A. filia nr 2 o. Zielona Góra, ul. Podgórna 50 65-246 Zielona
    Góra, Poland
    Beneficiary: Uniwersytet Zielonogórski, ul. Licealna 9, 65-417 Zielona Góra, Poland
    Beneficiary's account no.: PL 42 1500 1810 1218 1004 4483 0000
    Payment title: Konferencja FANCUD
    Cancellations will be accepted in writing prior to April 5, 2011. No refunds will be issued
    after that date. A PLN 100 (equivalent of €25) administration fee will be assessed on refunds
    issued.

    We look forward to hosting you in Zielona Góra!

    Conference Committee:
    Dr. Bogdan Trocha, Conference Head for Content and Program
    bwtrocha@gmail.com
    Dr. Tomasz Ratajczak, Conference Head for Program Scheduling
    t.ratajczak@ifp.uz.zgora.pl
    Dr. Agnieszka Ryzza-Woźniak, Division Head for the Russian-Speaking Section
    a_ryzza@o2.pl
    Dr. Joanna Ziobrowska, Division Head for the French-Speaking Section
    zfr@yahoo.fr
    Aleksander Rzyman, Division Head for the English-Speaking Section
    aleksander.rzyman@xl.wp.pl

    cfp categories: interdisciplinaryinternational_conferences 39068[UPDATE] CFP-"Decolonial Thinking in Latin American and Latina/o Literary Studies (ACLA March 31-April 3, 2011 Vancouver)Juan G. Ramosjgramos@complit.umass.edu1288835040cultural_studies_and_historical_approachesethnicity_and_national_identityinternational_conferencespostcolonialtheoryfull name / name of organization: Juan G. Ramoscontact email: jgramos@complit.umass.edu

    In his introduction to <> (2010), Walter Mignolo invites us to consider decolonial thinking "as a particular kind of critical theory and the de-colonial option as a specific orientation of doing." As a type of critical theory, decolonial thinking becomes an option from which we can be critical of existing master/universal narratives that pervade in society and academia. Because the modernity/coloniality/decoloniality project seeks to avoid becoming yet another master theory, we are confronted with the challenge of not falling into the trap of thinking about coloniality (colonial matrix of power) "as a model, a theory or an object of study." To prevent this from happening, we ought to delink ourselves from "the hegemonic and Eurocentred matrix of knowledge." Likewise, coloniality implies delinking our thinking from disciplinary constrictions and not thinking about modernity/coloniality/decoloniality from the strict vantage points of established disciplines. Instead, the project preoccupies itself with unearthing and articulating alternative ways of thinking from its dwellings in double consciousness, mestiza consciousness, border thinking, subaltern epistemologies, borders and peripheries of master narratives, and the undersides/darker sides of modernity.

    With this in mind, the panel invites papers that take up these critical challenges, particularly in relation to the disciplinary demands of Latin American and Latina/o literary studies. How might decolonial thinking help us to think beyond the current academic/scholarly boundaries we face in either Latin American or Latina/o literary studies? How might decolonial thinking help us collapse the disciplinary boundaries that separate Latin American and Latina/o literary studies as distinct fields of inquiry? Are there ways in which modernity/ coloniality / decoloniality might generate new critical tools or methodologies to investigate cultural productions that can be simultaneously situated in either field of literary study? In what ways might decolonial thinking help us deal with cultural manifestations that belong to spaces in-between Latin American and Latina/o literary studies and not specifically in either one? How might the axes of the colonial matrix of power (control of economy, control of authority, control of gender and sexuality, control of subjectivity and knowledge) help us address current debates in Latin American and/or Latina/o literary studies? How might decolonial thinking help us reflect about the place of Latin American and/or Latina/o literary studies within current discourses about world literature? Papers that engage with any of these questions based on the analysis of specific literary texts or case studies are particularly welcome. Approximations to the writings and concepts of the members of the modernity/coloniality/decoloniality working group or other specific problems germane to the topic are also welcome.

    Please submit paper proposals by Friday, November 12th, 2011 to http://www.acla.org/submit/index.php?override=xyzzy

    cfp categories: cultural_studies_and_historical_approachesethnicity_and_national_identityinternational_conferencespostcolonialtheory 39069[UPDATE}Australian Association for Caribbean Studies International Biennial Conference 2011Australian Association for Caribbean Studieskarina.smith@vu.edu.au1288839654cultural_studies_and_historical_approachesgender_studies_and_sexualityinterdisciplinarypostcolonialfull name / name of organization: Australian Association for Caribbean Studiescontact email: karina.smith@vu.edu.au

    *EXTENSION OF SUBMISSION DEADLINE*
    Australian Association for Caribbean Studies
    International Biennial Conference
    Newcastle, NSW, Australia
    16-18th February, 2011
    The ninth biennial conference of the Australian Association for Caribbean Studies (AACS) will be held in Newcastle, 16-18th February 2011.
    The theme for the conference is:
    Caribbean Narratives of Race, Place and Migration
    Keynote Speakers:
    Professor Karen Fog Olwig, University of Copenhagen, Denmark
    Professor Helen Tiffin, Formerly Professor of Literature at the University of Tasmania

    *Paper proposals that do not fit the conference theme are welcome*

    Proposals for papers of approx. 200 words should be sent to Dr Karina Smith at karina.smith@vu.edu.au. The deadline has been extended until December 10th, 2010.
    Postgraduate Bursaries
    The Australian Association for Caribbean Studies is pleased to offer a limited number of bursaries to assist students travelling to its biennial conference in 2011.

    For the Newcastle conference, the Association is able to offer three bursaries, one of $1,000 and two of $200 each. Applicants should be postgraduate students registered at Australian or overseas universities who have not been awarded their degrees at the time of the conference. Students travelling from overseas will be the preferred applicants for the $1000 bursary. To apply for a bursary please write to the President setting out why you want to come to the conference (400 words), together with an extended abstract of the paper you will give (up to 600 words). Applications should be received by the President, Dr Anne Hickling-Hudson (a.hudson@qut.edu.au), by 15th December 2010. Decisions will be announced shortly after that date.

    For further information regarding the conference, including venue, registration, accommodation and travel arrangements, please visit the AACS's website:
    http://sites.google.com/site/austassoccaribstudies/
    or contact Dr Rhona Hammond (rhona.hammond@gmail.com) or Dr Karina Smith (karina.smith@vu.edu.au)

    cfp categories: cultural_studies_and_historical_approachesgender_studies_and_sexualityinterdisciplinarypostcolonial 39071International Journal of Biometrics and Bioinformatics (IJBB)Computer Science Journalscfp@cscjournals.org1288853148journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    CALL FOR PAPER

    Journal: International Journal of Biometrics and Bioinformatics (IJBB)
    Volume: 4 Issue: 6
    ISSN: 1985-2347
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJBB

    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February

    About IJBB

    The International Journal of Biometric and Bioinformatics (IJBB) brings together both of these aspects of biology and creates a platform for exploration and progress of these, relatively new disciplines by facilitating the exchange of information in the fields of computational molecular biology and post-genome bioinformatics and the role of statistics and mathematics in the biological sciences. Bioinformatics and Biometrics are expected to have a substantial impact on the scientific, engineering and economic development of the world. Together they are a comprehensive application of mathematics, statistics, science and computer science with an aim to understand living systems.

    We invite specialists, researchers and scientists from the fields of biology, computer science, mathematics, statistics, physics and such related sciences to share their understanding and contributions towards scientific applications that set scientific or policy objectives, motivate method development and demonstrate the operation of new methods in the fields of Biometrics and Bioinformatics.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJBB.

    IJBB LIST OF TOPICS

    The realm of International Journal of Biometrics and Bioinformatics (IJBB) extends, but not limited, to the following:

    • Bio-ontology and data mining
    • Bioinformatic databases
    • Biomedical image processing (fusion)
    • Biomedical image processing (registration)
    • Biomedical image processing (segmentation)
    • Biomedical modelling and computer simulation
    • Computational genomics
    • Computational intelligence
    • Computational proteomics
    • Computational structural biology
    • Data visualisation
    • DNA assembly, clustering, and mapping
    • E-health
    • Fuzzy logic
    • Gene expression and microarrays
    • Gene identification and annotation
    • Genetic algorithms
    • Hidden Markov models
    • High performance computing
    • Molecular evolution and phylogeny
    • Molecular modelling and simulation
    • Molecular sequence analysis
    • Neural networks

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39072International Journal of Computer Science and Security (IJCSS)Computer Science Journalscfp@cscjournals.org1288853547journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJCSS
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Computer Science and Security (IJCSS)
    Volume: 4 Issue: 6
    ISSN: 1985-1553
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJCSS

    About IJCSS

    The International Journal of Computer Science and Security (IJCSS) is a refereed online journal which is a forum for publication of current research in computer science and computer security technologies. It considers any material dealing primarily with the technological aspects of computer science and computer security. The journal is targeted to be read by academics, scholars, advanced students, practitioners, and those seeking an update on current experience and future prospects in relation to all aspects computer science in general but specific to computer security themes. Subjects covered include: access control, computer security, cryptography, communications and data security, databases, electronic commerce, multimedia, bioinformatics, signal processing and image processing etc.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJCSS.

    IJCSS List of Topics

    The realm of International Journal of Computer Science and Security (IJCSS) extends, but not limited, to the following:

    • Bioinformatics
    • Communications and data security
    • Computer Engineering
    • Computer graphics
    • Computer Networks
    • Computer security
    • Cryptography
    • Data mining
    • Databases
    • Electronic commerce
    • Image processing
    • Object Orientation
    • Operating systems
    • Parallel and distributed processing
    • Programming languages
    • Robotics
    • Signal processing
    • Software engineering
    • Theory

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39073International Journal of Engineering (IJE)Computer Science Journalscfp@cscjournals.org1288853713journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJE
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Engineering (IJE)
    Volume: 4 Issue: 6
    ISSN: 1985-2312
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJE
    About IJE

    International Journal of Engineering (IJE) is devoted in assimilating publications that document development and research results within the broad spectrum of subfields in the engineering sciences. The journal intends to disseminate knowledge in the various disciplines of the engineering field from theoretical, practical and analytical research to physical implications and theoretical or quantitative discussion intended for both academic and industrial progress.

    Our intended audiences comprises of scientists, researchers, mathematicians, practicing engineers, among others working in Engineering and welcome them to exchange and share their expertise in their particular disciplines. We also encourage articles, interdisciplinary in nature. We welcome interested professionals to contribute into IJE research network by joining as an author of a peer-reviewed journal. Journal use an online, electronic submission process.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJE.
    IJE List of Topics:

    The realm of International Journal of Engineering (IJE) extends, but not limited, to the following
    • Computer Engineering
    • Control Systems Engineering
    • Education Engineering
    • Electrical Engineering
    • Electronic Engineering
    • Engineering Mathematics
    • Engineering Science
    • Environmental Engineering
    • Fluid Engineering
    • Geotechnical Engineering
    • Industrial Engineering
    • Manufacturing Engineering
    • Materials & Technology Engineering
    • Mechanical Engineering
    • Mineral & Mining Engineering
    • Nuclear Engineering
    • Optical Engineering
    • Petroleum Engineering
    • Robotics & Automation Engineering
    • Telecommunications Engineering

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39074International Journal of Image Processing (IJIP)Computer Science Journalscfp@cscjournals.org1288853816journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJIP
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Image Processing (IJIP)
    Volume: 4 Issue: 6
    ISSN: 1985-2304
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJIP

    About IJIP

    The International Journal of Image Processing (IJIP) aims to be an effective forum for interchange of high quality theoretical and applied research in the Image Processing domain from basic research to application development. It emphasizes on efficient and effective image technologies, and provides a central forum for a deeper understanding in the discipline by encouraging the quantitative comparison and performance evaluation of the emerging components of image processing.

    We welcome scientists, researchers, engineers and vendors from different disciplines to exchange ideas, identify problems, investigate relevant issues, share common interests, explore new approaches, and initiate possible collaborative research and system development.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJIP.

    IJIP List of Topics

    The realm of International Journal of Image Processing (IJIP) extends, but not limited, to the following:

    • Architecture of imaging and vision systems
    • Autonomous vehicles
    • Character and handwritten text recognition
    • Chemical and spectral sensitization
    • Chemistry of photosensitive materials
    • Coating technologiesPhysics and chemistry of AgX
    • Coding and transmission
    • Cognitive aspects of image understanding
    • Color imaging
    • Communication of visual data
    • Data fusion from multiple sensor inputs
    • Display and printing
    • Document image understanding
    • Generation and display
    • Holography
    • Image analysis and interpretation
    • Image capturing
    • Image databases
    • Image generation
    • Image manipulation
    • Image permanence
    • Image processing
    • Image processing applications
    • Image processing: coding analysis and recognition
    • Image representation
    • Image sensing
    • Imaging systems and image scanning
    • Implementation and architectures
    • Latent image
    • Materials for electro-photography
    • Monitoring and surveillance
    • Network architecture for real-time video transport
    • New visual services over ATM/packet network
    • Non-impact printing technologies
    • Object modeling and knowledge acquisition
    • Photoconductors
    • Photographic emulsions
    • Photopolymers
    • Prepress and printing technologies
    • Processing and analysis
    • Protocols for packet video
    • Remote image sensing
    • Retrieval and multimedia
    • Scene modeling
    • Signal-processing aspects of image processing
    • Storage and transmission
    • Video coding algorithms and technologies for ATM/p
    • Visual inspection

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39075International Journal of Security (IJS)Computer Science Journalscfp@cscjournals.org1288853986journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJS
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Security (IJS)
    Volume: 4 Issue: 6
    ISSN: 1985-2320
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJS

    About IJS
    Information Security is an important aspect of protecting the information society from a wide variety of threats. The International Journal of Security (IJS) presents publications and research that builds on computer security and cryptography and also reaches out to other branches of the information sciences. Our aim is to provide research and development results of lasting significance in the theory, design, implementation, analysis, and application of secure computer systems.

    IJS provides a platform to computer security experts, practitioners, executives, information security managers, academics, security consultants and graduate students to publish original, innovative and time-critical articles and other information describing research and good practices of important technical work in information security, whether theoretical, applicable, or related to implementation. It is also a platform for the sharing of ideas about the meaning and implications of security and privacy, particularly those with important consequences for the technical community. We welcome contributions towards the precise understanding of security policies through modeling, as well as the design and analysis of mechanisms for enforcing them, and the architectural principles of software and hardware system implementing them.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJS.

    IJS List of Topics
    The realm of International Journal of Security (IJS) extends, but not limited, to the following:

    • Anonymity
    • Anonymity and pseudonymity
    • Attacks, security mechanisms, and security service
    • Authentication
    • Authorisation
    • Biometrics
    • Cellular/wireless/mobile/satellite networks securi
    • Code security, including mobile code security
    • Computer forensics
    • Confidentiality, privacy, integrity, authenticatio
    • Cryptography and cryptanalysis
    • Data confidentiality issues
    • Data integrity issues
    • Data recovery
    • Database security
    • Denial of service
    • Denial of service attacks and countermeasures
    • Dependability and reliability
    • Design or analysis of security protocols
    • Distributed access control
    • Distributed and parallel systems security
    • Electronic commerce
    • Formal security analyses
    • Fraudulent usage
    • Information flow
    • Information hiding and watermarking
    • Intellectual property protection
    • Intrusion detection
    • Key management
    • Multicast security
    • Network and Internet security
    • Network forensics
    • Network security performance evaluation
    • Non-repudiation
    • Peer-to-peer security
    • Prevention of traffic analysis
    • Privacy protection
    • Public key cryptography and key management
    • Revocation of malicious parties
    • Risk assessment and management
    • Secure location determination
    • Secure PHY/MAC/routing protocols
    • Secure routing protocols
    • Security group communications
    • Security in ad hoc networks
    • Security in cellular networks (2G, 2.5G, 3G, B3G,
    • Security in communications
    • Security in content-delivery networks
    • Security in distributed systems
    • Security in domain name service
    • Security in e-mail
    • Security in high-speed networks
    • Security in integrated networks
    • Security in integrated wireless networks
    • Security in internet and WWW
    • Security in IP networks
    • Security in mobile IP
    • Security in optical systems and networks
    • Security in peer-to-peer networks
    • Security in satellite networks
    • Security in sensor networks
    • Security in VoIP
    • Security in wired and wireless integrated networks
    • Security in Wired Networks
    • Security in wireless communications
    • Security in wireless internet
    • Security in wireless LANs (IEEE 802.11 WLAN, WiFi,
    • Security in wireless MANs (IEEE 802.16 and WiMAX)
    • Security in wireless PANs (Bluetooth and IEEE 802.
    • Security policies
    • Security specification techniques
    • Security standards
    • Tradeoff analysis between performance and security
    • Trust establishment
    • Viruses worms and other malicious code
    • WLAN and Bluetooth security

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39076Signal Processing: An International Journal (SPIJ)Computer Science Journalscfp@cscjournals.org1288854234journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=SPIJ
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: Signal Processing: An International Journal (SPIJ)
    Volume: 4 Issue: 6
    ISSN: 1985-2339
    URL: http://www.cscjournals.org/csc/description.php?JCode=SPIJ

    About SPIJ
    The International Journal of Signal Processing (SPIJ) lays emphasis on all aspects of the theory and practice of signal processing (analogue and digital) in new and emerging technologies. It features original research work, review articles, and accounts of practical developments. It is intended for a rapid dissemination of knowledge and experience to engineers and scientists working in the research, development, practical application or design and analysis of signal processing, algorithms and architecture performance analysis (including measurement, modeling, and simulation) of signal processing systems.

    As SPIJ is directed as much at the practicing engineer as at the academic researcher, we encourage practicing electronic, electrical, mechanical, systems, sensor, instrumentation, chemical engineers, researchers in advanced control systems and signal processing, applied mathematicians, computer scientists among others, to express their views and ideas on the current trends, challenges, implementation problems and state of the art technologies.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for SPIJ.

    SPIJ List of Topics
    The realm of International Journal of Signal Processing (SPIJ) extends, but not limited, to the following:

    Biomedical Signal Processing
    Communication Signal Processing
    Data Processing
    Detection and Estimation
    Digital Signal Processing
    Earth Resources Signal Processing
    Geophysical and Astrophysical Signal Processing
    Industrial Applications
    Multi-dimensional Signal Processing
    Optical Signal Processing
    Pattern Recognition
    Radar Signal Processing
    Remote Sensing
    Signal Filtering
    Signal Processing Systems
    Signal Processing Technology
    Signal Theory
    Software Developments
    Sonar Signal Processing
    Spectral Analysis
    Speech Processing
    Stochastic Processes

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39077International Journal of Computer Networks (IJCN)Computer Science Journalscfp@cscjournals.org1288854605journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJCN
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Computer Networks (IJCN)
    Volume: 4 Issue: 6
    ISSN: 1985-4129
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJCN

    About IJCN

    The International Journal of Computer Networks (IJCN) is an archival, bimonthly journal committed to the timely publications of peer-reviewed and original papers that advance the state-of-the-art and practical applications of computer networks. It provides a publication vehicle for complete coverage of all topics of interest to network professionals and brings to its readers the latest and most important findings in computer networks.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJCN.

    IJCN List of Topics
    The realm of International Journal of Computer Networks (IJCN) extends, but not limited, to the following:


    • Ad-hoc Wireless Networks
    • Algorithms, Systems and Applications
    • ATM Networks
    • Body Sensor Networks
    • Cellular Networks
    • Cognitive Radio Networks
    • Congestion and Flow Control
    • Cooperative Networks
    • Delay Tolerant Networks
    • Fault Tolerant Networks
    • Information Theory
    • Local Area Networks
    • Metropolitan Area Networks
    • MIMO Networks
    • Mobile Computing
    • Mobile Satellite Networks
    • Multicast and Broadcast Networks
    • Multimedia Networks
    • Network Architectures and Protocols
    • Network Coding
    • Network Modeling and Performance Analysis Network
    • Network Operation and Management
    • Network Security and Privacy
    • Network Services and Applications
    • Optical Networks
    • Peer-to-Peer Networks
    • Personal Area Networks
    • Switching and Routing
    • Telecommunication Networks
    • Trust Worth Computing
    • Ubiquitous Computing
    • Web-based Services
    • Wide Area Networks
    • Wireless Local Area Networks
    • Wireless Mesh Networks
    • Wireless Sensor Networks

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39078Advances in Multimedia - An International Journal (AMIJ)Computer Science Journalscfp@cscjournals.org1288854750journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=AMIJ
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: Advances in Multimedia - An International Journal (AMIJ)
    Volume: 1 Issue: 3
    ISSN: 2180-1223
    URL: http://www.cscjournals.org/csc/description.php?JCode=AMIJ

    About AMIJ
    Advances in Multimedia – An International Journal (AMIJ) is a peer-review journal presenting the theory and practice of multimedia including image and video processing problems. AMIJ aims at disseminating high level research results and engineering developments to all Image or Video Processing researchers and research groups. The journal features original research work, review and tutorial papers and accounts of practical developments. By presenting practical solutions for the current Image and Video processing problems, AMIJ is intended for the rapid dissemination of knowledge and experience to Scientists and Engineers working in any area related to or using Multimedia, Image and Video Processing.

    It features practical results, applications, and contributions that describe advances in such areas as multimedia analysis, multimedia compression, multimedia encoding, multimedia search and retrieval, multimedia systems, computer vision, visualization, computer animation etc.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for AMIJ.

    AMIJ List of Topics
    The realm of Advances in Multimedia – An International Journal (AMIJ) extends, but not limited, to the following:

    • 2D to 3D conversion Active Learning
    • Animation
    • Applications of Visual and Multimedia Techniques
    • Color and Multi-Spectral Processing
    • Computer Animation
    • Computer Vision
    • Displaying
    • Dynamic Modeling
    • Image-Based Rendering
    • Motion Capture and Synthesis
    • Multimedia Aanalysis
    • Multimedia Compression
    • Multimedia Encoding
    • Multimedia Retrieval
    • Multimedia Search
    • Multimedia Signal Processing
    • Multimedia Systems
    • Non-Photorealistic Rendering
    • Printing
    • Rendering Models
    • Scanning
    • Texturing
    • Virtual Reality
    • Visualization

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39079Geoinformatica - An International Journal (GIIJ)Computer Science Journalscfp@cscjournals.org1288854941journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=GIIJ
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: Geoinformatica - An International Journal (GIIJ)
    Volume: 1 Issue: 2
    ISSN: 2180-1231
    URL: http://www.cscjournals.org/csc/description.php?JCode=GIIJ

    About GIIJ
    Fast and mobile Internet access as well as a comprehensive standardization of the data exchange has opened the door to many new applications. Typical examples are spatial data infrastructures. They enable an overlay of data that reside on different computers but are geometrically referred to the same area. Spatial data infrastructures revolutionize the relations of citizens with administration and economy. Another booming field is location based services. This links mobile devices with spatial and temporal data. The most advanced concept is called "Ubiquitous GIS" which handles a great number of position-coded mobile objects such as containers within one system. The automatic administration of those objects has already gained importance within logistic enterprises.

    According to the above mentioned thoughts, Geoinformatica – An International Journal (GIIJ) aims at publishing scientific and technical developments in the diverse field of Geoinformatics. GIIJ covers all aspects and information on scientific and technical advances in the geomatic sciences. The journal is providing a platform for exploring research, development and innovative applications in geographic information science and related areas. GIIJ provides a privileged view of what is currently happening in the field of geoinformatics as well as a preview of what could be the hottest developments and research topics in the near future. Additionally, it includes recent research results on spatial databases, spatial ontologies, computational geometry and visualization for geographic information systems, geostatistics and spatial statistics, spatial analysis, interoperability, and innovative applications of geotechnologies.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for GIIJ.

    GIIJ List of Topics
    The realm of Geoinformatica - An International Journal (GIIJ) extends, but not limited, to the following:

    • Close Range and Videometric Photogrammetry
    • Computational Geometry and Visualization
    • Digital Mapping
    • Distributed GIS/GIS and the Internet
    • Geo Tags
    • Geodata: Capture, Sources and Standards
    • Geographic Data
    • Geographic Information
    • Geographic Information Science
    • Geoinformatics
    • Geospatial Applications
    • Geospatial Databases
    • Geospatial Processing
    • Geospatial Web
    • Geostatistics
    • Global Positioning System
    • Guidance Systems
    • Integrated Geodesy
    • land and Geographic Information Systems
    • Location-Based Services
    • Map Services
    • Mobile Maps
    • Remote Sensing
    • Sensor Networks
    • Sensor Web
    • Spatial Cognition
    • Spatial Data Analysis
    • Spatial Databases
    • Spatial Ontologies and Interoperability
    • Surface Modelling
    • Web Services

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39080International Journal of Artificial Intelligence and Expert Systems (IJAE)Computer Science Journalscfp@cscjournals.org1288855057journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJAE
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Artificial Intelligence and Expert Systems (IJAE)
    Volume: 1 Issue: 4
    ISSN: 2180-124x
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJAE

    About IJAE
    The main aim of the International Journal of Artificial Intelligence and Expert Systems(IJAE) is to provide a platform to AI & Expert Systems (ES) scientists and professionals to share their research and report new advances in the field of AI and ES. IJAE is a refereed journal producing well-written original research articles and studies, high quality papers as well as state-of-the-art surveys related to AI and ES. By establishing an effective channel of communication between theoretical researchers and practitioners, IJAE provides necessary support to practitioners in the design and development of intelligent and expert systems, and the difficulties faced by the practitioners in using the theoretical results provide feedback to the theoreticians to revalidate their models. IJAE thus meets the demand of both theoretical and applied researchers in artificial intelligence, soft computing and expert systems.

    IJAE is a broad journal covering all branches of Artificial Intelligence and Expert Systems and its application in the topics including but not limited to technology & computing, fuzzy logic, expert systems, neural networks, reasoning and evolution, automatic control, mechatronics, robotics, web intelligence applications, heuristic and AI planning strategies and tools, computational theories of learning, intelligent system architectures.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJAE.

    IJAE List of Topics
    The realm of International Journal of Artificial Intelligence and Expert Systems(IJAE) extends, but not limited, to the following:

    • Biomedical Signal Processing
    • Communication Signal Processing
    • Data Processing
    • Detection and Estimation
    • Digital Signal Processing
    • Earth Resources Signal Processing
    • Geophysical and Astrophysical Signal Processing
    • Industrial Applications
    • Multi-dimensional Signal Processing
    • Optical Signal Processing
    • Pattern Recognition
    • Radar Signal Processing
    • Remote Sensing
    • Signal Filtering
    • Signal Processing Systems
    • Signal Processing Technology
    • Signal Theory
    • Software Developments
    • Sonar Signal Processing
    • Spectral Analysis
    • Speech Processing
    • Stochastic Processes

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39081International Journal of Applied Sciences (IJAS)Computer Science Journalscfp@cscjournals.org1288855155journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJAS
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Applied Sciences (IJAS)
    Volume: 1 Issue: 2
    ISSN: 2180-1258
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJAS

    About IJAS

    International Journal of Applied Sciences (IJAS) is publishing articles in all areas of applied sciences. IJAS seeks to promote and disseminate knowledge in the applied sciences, natural and social sciences industrial research materials science and technology, energy technology and society including impacts on the environment, climate, security, and economy, environmental sciences, physics of the games, creativity and new product development, professional ethics, hydrology and water resources, wind energy. IJAS is an academic peer reviewed on-line international journal of broad appeal aimed at fast publication of cutting edge multidisciplinary research articles reporting on original research across the fields of pure and applied sciences.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJAS.

    IJAS List of Topics
    The realm of International Journal of Applied Sciences (IJAS) extends, but not limited, to the following:

    • Agricultura
    • Architectural
    • Audio
    • Automotive
    • Traffic
    • Transport
    • Environmental Engineering Science
    • Environmental Risk Assessment
    • Biochemical
    • Biological
    • Biomedical
    • Bombs
    • Broadcast
    • Building officials
    • Ceramic
    • Chemical
    • Civil
    • Combat Engineering
    • Construction
    • Cryogenics
    • Domestic appliances
    • Domestic Educational Technologies
    • Domestic Technology
    • Energy
    • Energy storage
    • Engineering geology
    • Enterprise
    • Entertainment
    • Environmental technology
    • Financial Engineering
    • Fire Protection Engineering
    • Fisheries science
    • Fishing
    • Food
    • Food Technology
    • Genetic
    • Health Safety
    • Health Technologies
    • Industrial Technology
    • Industry Business Informatics
    • Machinery
    • Manufacturing
    • Marine Engineering
    • Material Sciences
    • Materials science and engineering
    • Medical Technology
    • Metallurgical
    • Microtechnology
    • Military Ammunition
    • Military Technology
    • Military Technology and equipment
    • Mining
    • Motor Vehicles
    • Music
    • Naval Engineering
    • Nuclear technology
    • Nutrition
    • Ocean
    • Ontology
    • Optical
    • Optics
    • Particle physics
    • Pharmaceuticals
    • Safety Engineering
    • Sanitary Engineering
    • Space Technology
    • Textile
    • Tissue
    • Visual Technology
    • Zoography

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39082International Journal of Computational Linguistics (IJCL)Computer Science Journalscfp@cscjournals.org1288855273journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJCL
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Computational Linguistics (IJCL)
    Volume: 1 Issue: 4
    ISSN: 2180-1266
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJCL

    About IJCL
    Computational linguistics is an interdisciplinary field dealing with the statistical and/or rule-based modeling of natural language from a computational perspective. Today, computational language acquisition stands as one of the most fundamental, beguiling, and surprisingly open questions for computer science. With the aims to provide a scientific forum where computer scientists, experts in artificial intelligence, mathematicians, logicians, cognitive scientists, cognitive psychologists, psycholinguists, anthropologists and neuroscientists can present research studies, International Journal of Computational Linguistics (IJCL) publish papers that describe state of the art techniques, scientific research studies and results in computational linguistics in general but on theoretical linguistics, psycholinguistics, natural language processing, grammatical inference, machine learning and cognitive science computational models of linguistic theorizing: standard and enriched context free models, principles and parameters models, optimality theory and researchers working within the minimalist program, and other approaches. IJCL is a peer review journal and a bi-monthly journal.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJCL.

    IJCL List of Topics
    The realm of International Journal of Computational Linguistics (IJCL) extends, but not limited, to the following:

    • Computational Linguistics
    • Computational Models
    • Computational Theories
    • Corpus Linguistics
    • Formal Linguistics-Theoretic and Grammar Induction
    • Information Retrieval and Extraction
    • Language Generation
    • Language Learning
    • Linguistics Modeling Techniques
    • Linguistics Theories
    • Machine Translation
    • Models of Language Change and its Effect on Lingui
    • Models that Address the Acquisition of Word-order
    • Models that Combine Linguistics Parsing
    • Models that Employ Statistical/probabilistic Gramm
    • Models that Employ Techniques from machine learnin
    • Natural Language Processing
    • Quantitative Linguistics
    • Speech Analysis/Synthesis
    • Speech Recognition/Understanding
    • Spoken Dialog Systems
    • Web Information Extraction/Mining

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39083International Journal of Data Engineering (IJDE)Computer Science Journalscfp@cscjournals.org1288855417journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJDE
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Data Engineering (IJDE)
    Volume: 1 Issue: 5
    ISSN: 2180-1274
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJDE

    About IJDE

    Data Engineering refers to the use of data engineering techniques and methodologies in the design, development and assessment of computer systems for different computing platforms and application environments. With the proliferation of the different forms of data and its rich semantics, the need for sophisticated techniques has resulted an in-depth content processing, engineering analysis, indexing, learning, mining, searching, management, and retrieval of data.

    International Journal of Data Engineering (IJDE) is a peer reviewed scientific journal for sharing and exchanging research and results to problems encountered in today's data engineering societies. IJDE especially encourage submissions that make efforts (1) to expose practitioners to the most recent research results, tools, and practices in data engineering topics; (2) to raise awareness in the research community of the data engineering problems that arise in practice; (3) to promote the exchange of data & information engineering technologies and experiences among researchers and practitioners; and (4) to identify new issues and directions for future research and development in the data & information engineering fields. IJDE is a peer review journal that targets researchers and practitioners working on data engineering and data management.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJDE.

    IJDE List of Topics

    The realm of International Journal of Data Engineering (IJDE) extends, but not limited, to the following:

    • Approximation and Uncertainty in Databases and Pro
    • Autonomic Databases
    • Data Engineering
    • Data Engineering Algorithms
    • Data Engineering for Ubiquitous Mobile Distributed
    • Data Engineering Models
    • Data Integration
    • Data Mining and Knowledge Discovery
    • Data Ontologies
    • Data Privacy and Security
    • Data Query Optimization in Databases
    • Data Streams and Sensor Networks
    • Data Warehousing
    • Database Tuning
    • Database User Interfaces and Information Visualiza
    • Knowledge Technologies
    • Metadata Management and Semantic Interoperability
    • OLAP and Data Grids
    • Personalized Databases
    • Query Processing in Databases
    • Scientific Biomedical and Other Advanced Database
    • Semantic Web
    • Social Information Management
    • Spatial Temporal and Multimedia Data Engineering
    • Web Data Engineering and Management

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39084International Journal of Experimental Algorithms (IJEA)Computer Science Journalscfp@cscjournals.org1288855544journals_and_collections_of_essaysprofessional_topicsscience_and_culturefull name / name of organization: Computer Science Journalscontact email: cfp@cscjournals.org

    URL: http://www.cscjournals.org/csc/description.php?JCode=IJEA
    Important Dates
    Paper Submission: November 30, 2010
    Author Notification: January 01, 2011
    Issue Publication: January / February
    Journal: International Journal of Experimental Algorithms (IJEA)
    Volume: 1 Issue: 1
    ISSN: 2180-1282
    URL: http://www.cscjournals.org/csc/description.php?JCode=IJEA
    About IJEA
    Experimental Algorithmics studies algorithms and data structures by joining experimental studies with the more traditional theoretical analyses. With this regard, the aim of The International Journal of Experimental Algorithms (IJEA) is (1) to stimulate research in algorithms based upon implementation and experimentation; in particular, to encourage testing, evaluation and reuse of complex theoretical algorithms and data structures; and (2) to distribute programs and testbeds throughout the research community and to provide a repository of useful programs and packages to both researchers and practitioners. IJEA is a high-quality, refereed, archival journal devoted to the study of algorithms and data structures through a combination of experimentation and classical analysis and design techniques. IJEA contributions are also in the area of test generation and result assessment as applied to algorithms.

    To build its International reputation, we are disseminating the publication information through Google Books, Google Scholar, Directory of Open Access Journals (DOAJ), Open J Gate, ScientificCommons, Docstoc and many more. Our International Editors are working on establishing ISI listing and a good impact factor for IJEA.

    IJEA List of Topics
    The realm of International Journal of Experimental Algorithms (IJEA) extends, but not limited, to the following:
    • Algorithmic Code
    • Algorithmic Engineering
    • Algorithmic Network Analysis
    • Analysis of Algorithms
    • Approximation Techniques
    • Cache Oblivious algorithm
    • Combinatorial Optimization
    • Combinatorial Structures and Graphs
    • Computational Biology
    • Computational Geometry
    • Computational Learning Theory
    • Computational Optimization
    • Data Structures
    • Distributed and Parallel Algorithms
    • Dynamic Graph Algorithms
    • Experimental Techniques and Statistics
    • Graph Manipulation
    • Graphics
    • Heuristics
    • Mathematical Programming For Algorithms
    • Metaheuristic Methodologies
    • Network Design
    • Parallel Processing
    • Randomized Techniques in Algorithms
    • Routing and Scheduling
    • Searching and Sorting
    • Topological Accuracy
    • Visualization Code
    • VLSI Design

    cfp categories: journals_and_collections_of_essaysprofessional_topicsscience_and_culture 39085The Acacia Group at Cal State University, Fullerton, 2011 Graduate Conference, RetaliatiThe Acacia Groupacaciagroup.csuf@gmail.com1288859794african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsgraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryinternational_conferencesjournals_and_collections_of_essaysmedievalmodernist studiespoetrypopular_culturepostcolonialprofessional_topicsreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorianfull name / name of organization: The Acacia Groupcontact email: acaciagroup.csuf@gmail.com

    The Acacia Group at Cal State University, Fullerton is currently accepting proposals for its 2011 Graduate Conference, Retaliation. The Acacia Group is an organization of English graduate students and faculty members committed to developing student scholastic advancement while fostering a strong sense of academic community.
    This year's theme will address the issue of Justice (or lack thereof) in literature and contemporary culture. The focus of the conference is to engage with justice as both an abstract theoretical concept and a material reality that impacts individuals and populations. Throughout history, everyone from philosophers such as Plato and Cephalus to community organizers such as Cesar Chavez and Martin Luther King have wrestled with ideas about justice that might create an ideal society. Topics may include, but are not limited to: how justice has been represented in the text, the changing context of justice, the misuse/corruption of justice, the way justice has evolved, retributive justice, distributive justice, oppressive law, or any other sub categories.

    While the Acacia Conference is organized to meet the needs of graduate students and faculty, we welcome contributions from academics at all levels. We extend a warm invitation to various disciplines: English, Rhetoric and Composition, Creative Writing, Linguistics, Comparative Literature, American Studies, History Philosophy, Political Science, Gender Studies, Ethnic Studies, Art History, Film and Television Studies, Popular Culture, etc.

    For individual papers, please submit a 250-word abstract and a brief biography (only 1-3 sentences). Due to the nature of this year's theme, we are also welcoming coauthored papers as well as panel submissions. For panels, please submit a 250-word description of the panel topic in addition to the individual paper submissions. Submissions should be sent acaciagroup.csuf@gmail.com by December 15, 2010. In the subject line please label it Acacia 2011. Please include the title of your paper, school affiliation (if any), and your e-mail address along with your submission.

    cfp categories: african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsgraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryinternational_conferencesjournals_and_collections_of_essaysmedievalmodernist studiespoetrypopular_culturepostcolonialprofessional_topicsreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorian 39086Call for Papers: Interdisciplinary Relationships between Science and ArtRupkatha Journal on Interdisciplinary Studies in Humanitieseditor@rupkatha.com1288866168cultural_studies_and_historical_approachesecocriticism_and_environmental_studiesgeneral_announcementshumanities_computing_and_the_internetinterdisciplinaryjournals_and_collections_of_essaysscience_and_culturetwentieth_century_and_beyondfull name / name of organization: Rupkatha Journal on Interdisciplinary Studies in Humanitiescontact email: editor@rupkatha.com

    Rupkatha Journal on Interdisciplinary Studies in Humanities
    ISSN 0975-2935 ● www.rupkatha.com
    Call for Papers (Vol 3, No 1, January 2011)

    THE THEME
    Ever since 'art' was separated from 'science', controversies and doubts have baffled human mind as to whether 'art' should at all be viewed as a separate sphere of study and practice, whether or not the two spheres share some common characteristics, whether science and art influence each other, and so on. In the next issue (Vol 3, No 1, January 2011) of Rupkatha Journal on Interdisciplinary Studies in Humanities, we seek to explore the interdisciplinary relationship between science and art. Possible topics for discussions are given below. But we are open to suggestions of inclusion of other relevant topics under the theme.

    TOPICS
    General Topics
    Aesthetics of science
    Science of art
    Metatheories of science and art
    Scientific discoveries and inventions and their influence on art
    The function of language in scientific and artistic discourses
    Interpretation of scientific and artistic discourses
    Patterns of scientific and literary discourses
    Interdisciplinarity as a mode of research
    Influence of the digital technology and communication sciences of art and language
    Science fiction as the meeting point of science and art
    Particular Topics
    Discussion of a particular artist or scientist whose works explore the interdisciplinary connections between science and art
    Discussion of particular scientific or artistic discourse/s (work/s) illustrating/containing the connections

    Creative Works
    We would like to feature art-works exploring/displaying interdisciplinary themes/perspective on science and art.

    Book Reviews
    Reviews of Books on Interdisciplinary connections between science and art (book not older than two years to be reviewed0

    CONTACT
    Email: editor@rupkatha.com
    Please visit http://rupkatha.com/submissionguidelines.php for submission guidelines.

    DEADLINE OF SUBMISSION: December 30, 2010.

    cfp categories: cultural_studies_and_historical_approachesecocriticism_and_environmental_studiesgeneral_announcementshumanities_computing_and_the_internetinterdisciplinaryjournals_and_collections_of_essaysscience_and_culturetwentieth_century_and_beyond 39087Book Destruction: Call For Papers for a Conference at Senate House, University of London 16 April 2011Birkbeck College, University of Londonadam.smyth@bbk.ac.uk or g.partington@bbk.ac.uk1288869572bibliography_and_history_of_the_bookcultural_studies_and_historical_approacheseighteenth_centuryhumanities_computing_and_the_internetinterdisciplinarymedievalrenaissancetwentieth_century_and_beyondvictorianfull name / name of organization: Birkbeck College, University of Londoncontact email: adam.smyth@bbk.ac.uk or g.partington@bbk.ac.uk

    Much attention has been given in recent years to the book as a material, historical object and its possible technological obsolescence in the era of digitization. Such reflections have tended to concentrate on the production and cultural circulation of books, their significance and their power to shape knowledge and subjectivities. But there is another aspect to our interactions with the book which remains relatively unexplored: the history of book destruction. In certain circumstances books are treated not with reverence but instead with violence or disregard. This conference invites reflections on this alternative history of the book, and we welcome papers from a range of historical periods and disciplinary backgrounds. We welcome proposals from postgraduate students, as well as from more established academics.

    Why do people destroy books? What are the mechanics of book destruction: the burning, pulping, defacing, tearing, drowning, cutting, burying, eating? What are the cultural meanings that have been attached to book destruction, and what do they reveal about our investments in this over-familiar object? Why should the burning of books have such symbolic potency? Book destruction is often invoked as a symbol of oppressive, despotic regimes; what is our ethical position, now, in relation to such acts? What is the relationship between book destruction and other forms of cutting up (quotation; collage)? When do acts of destruction become moments of creativity? How does destruction relate to recycling and reuse? Do transitions in media (manuscript to print; print to digital) threaten those older forms? How might the current phase of digitization and the gradual disappearance of library stock relate to prior moments of destruction? In the internet age, is it still possible to destroy (that is, completely erase) a text? What does materiality mean in a digital age?

    Please send 300-word proposals (for a 20 minute paper) and a brief CV by January 10th 2011.

    cfp categories: bibliography_and_history_of_the_bookcultural_studies_and_historical_approacheseighteenth_centuryhumanities_computing_and_the_internetinterdisciplinarymedievalrenaissancetwentieth_century_and_beyondvictorian 39088Shakespeare and DerridaOxford Literary Reviewn.w.o.royle@sussex.ac.uk1288870274general_announcementsjournals_and_collections_of_essaysrenaissancetheoryfull name / name of organization: Oxford Literary Reviewcontact email: n.w.o.royle@sussex.ac.uk

    Shakespeare and Derrida (OLR vol.34, no. 1)

    How has Derrida's work affected and even transformed the ways in which Shakespeare is read? What are the continuing ramifications and effects of deconstructive thinking for Shakespeare Studies? Conversely, how might the writings of Shakespeare help us to read Derrida – for example, with regard to questions of language, dramatic form, writing, voice, signature, politics and ethics, history and the present, nature, mercy, cruelty, love, desire, sexual difference, irony, shame, dignity, laughter, animals, spectrality, mourning, friendship and so on? Derrida gives extended and detailed attention to Shakespeare's writings in a number of texts: Spectres of Marx and 'The Time Is Out of Joint' (on Hamlet), 'Aphorism Countertime' (on Romeo and Juliet) and 'What Is a Relevant Translation?' (on The Merchant of Venice). He also makes briefer but provoking reference to Timon of Athens (in Spectres) and King Lear (in 'My Chances'), among other places. Contributors may wish to draw on quite different work by Derrida, however, and elaborate quite different analyses, correspondences and trajectories.
    The Oxford Literary Review would welcome essays of up to around 6,000 words.
    Contributors should submit their essays to Nicholas Royle, School of English, University of Sussex, Brighton BN1 9QN, UK. You are also welcome to correspond with him, if you wish, at n.w.o.royle@sussex.ac.uk
    Deadline for submissions: 30 November 2011.
    Publication date: 2012.

    cfp categories: general_announcementsjournals_and_collections_of_essaysrenaissancetheory 39089Precarious Subjects: Borders, Interstices, and Instabilities in Literature and Culture, April 1-2, 2011Eric D. Smith and Holly Flint/ Department of English Graduate Student Conference, University of Alabama in Huntsvilleeric.smith@uah.edu1288878244african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsgraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryinternational_conferencesjournals_and_collections_of_essaysmedievalmodernist studiespoetrypopular_culturepostcolonialprofessional_topicsreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorianfull name / name of organization: Eric D. Smith and Holly Flint/ Department of English Graduate Student Conference, University of Alabama in Huntsvillecontact email: eric.smith@uah.edu

    Keynote speakers: José E. Muñoz and Ernesto Quiñonez

    We invite graduate student submissions from all areas of literary and cultural studies and from all critical and theoretical perspectives that explore the capacity of the precarious condition to call into being new subjects or to articulate novel expressions of subjectivity. From its recent deployment as an organizational concept in the study of labor to its use more broadly to label a condition of self in the era of globalization, precarity has emerged as a central topic of interest for sociology, philosophy, and cultural studies. For those of us interested in the production and interpretation of literary and cultural artifacts, the notion of precarity has any number of disruptive or generative implications. For instance, what happens to traditional formulas for literary periodization, generic classification, or even disciplinarity itself in the precarious cultural moment? How does precarity invite a renewed interrogation of both canons and margins, of ethnic, national, racial, sexual, gender, or class identifications?

    Papers may include considerations of the precarious, broadly conceived, in topics such as the following:
    Feminism
    Critical race theory
    Postcolonial studies
    Ecocriticism
    Utopia/Dystopia
    Film studies
    Globalization
    Queer theory
    Citizenship studies
    Border studies
    Architecture
    Science Fiction
    Science and technology
    Comics/graphic novels
    Genre studies
    Literary/historical periodization

    Please submit a 200-300 word abstract by February 1, 2011, to
    eric.smith@uah.edu.

    cfp categories: african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsgraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryinternational_conferencesjournals_and_collections_of_essaysmedievalmodernist studiespoetrypopular_culturepostcolonialprofessional_topicsreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorian 39090UPDATE: UCA's Fifth Annual English Graduate Conference on LiteratureMary Ruth Marotte, Graduate Director, University of Central Arkansasmrmarotte@uca.edu1288879863african-americanamericanethnicity_and_national_identityfilm_and_televisiongeneral_announcementsgraduate_conferencesinterdisciplinarypoetrytheatretwentieth_century_and_beyondfull name / name of organization: Mary Ruth Marotte, Graduate Director, University of Central Arkansascontact email: mrmarotte@uca.edu

    Call for Papers
    UCA's Fifth Annual
    English Graduate Conference on Literature

    Shakespeare:
    Pedagogy, Scholarship, and Performance

    April 14-15, 2011
    University of Central Arkansas

    When Ben Jonson wrote that William Shakespeare was "not of an age, but for all time," he could not have realized the full impact of his words. Nearly 400 years after his death, the bard still mesmerizes us. We invite papers on any aspect of Shakespearean studies.

    Though the conference theme centers on Shakespeare, we also welcome submissions on any topic related to all genres of literature, theory, culture, and film, as well as creative submissions of poetry, fiction, and drama.

    250-word abstracts and/or panel proposals must be emailed by March 15, 2010 to net06001@uca.edu with "Conference Submission" in the subject line.

    Keynote Speaker:
    Jacqueline Vanhoutte, Associate Professor of English, University of North Texas
    Dr. Vanhoutte earned a B.A. in English Literature from Carleton College and a Ph.D. from the University of Washington. She has published a number of essays on early English drama and court culture; her most recent article, entitled "Elizabeth I as Stepmother," appeared in ELR: English Literary Renaissance. Dr. Vanhoutte is also the author of Strange Communion: Motherland and Masculinity in Tudor Plays, Pamphlets, and Politics (University of Delaware Press, 2003) and co-author, with Laurel Amtower, of A Companion to Chaucer and His Contemporaries (Broadview, 2009). She is currently at work on a book about Shakespeare and the Elizabethan court, tentatively entitled ¬Age in Love: Shakespeare at the Court of Elizabeth I."

    Guest Poet:
    Greg Alan Brownderville is a native of Pumpkin Bend, Arkansas. Winner of the 2007 Porter Prize, Brownderville has published a substantial body of work in journals and magazines such as the Oxford American and Measure. Primarily a poet, Greg is also a folklorist and a writer of fiction, creative nonfiction, and literary criticism. His latest collection is Deep Down in the Delta.

    Sponsored by the University of Central Arkansas Department of English and Sigma Tan Delta

    cfp categories: african-americanamericanethnicity_and_national_identityfilm_and_televisiongeneral_announcementsgraduate_conferencesinterdisciplinarypoetrytheatretwentieth_century_and_beyond 39091Collection of Essays on the Role of Music in Multicultural Activism UPDATEEd. Eunice Rojas, Lindsay Michie Eades,eades.l@lynchburg.edu, rojas.e@lynchburg.edu1288892122african-americancultural_studies_and_historical_approachesethnicity_and_national_identityinterdisciplinaryjournals_and_collections_of_essayspopular_culturetwentieth_century_and_beyondfull name / name of organization: Ed. Eunice Rojas, Lindsay Michie Eades,contact email: eades.l@lynchburg.edu, rojas.e@lynchburg.edu

    This book is a two volume series of essays telling stories of the ways in which music has propelled resistance and revolutionary movements in the United States and around the world from the gospel music of slavery in the antebellum South to anti-apartheid freedom songs in South Africa.
    The two-volume series will illustrate a consistent pattern of musical influence on political resistance movements by providing accounts describing a vast array of musical styles from diverse parts of the world. One volume will cover movements in the U.S. and the other will have an international focus. The purpose of this series is to encompass a wide perspective on the role of music in political activism.
    We welcome submissions on a variety of topics and geographical areas. We are especially interested in essays that deal with the following:
    • Hip Hop in the U.S.
    • Music and U.S. Slave resistance
    • Northern Africa
    • Middle East
    • Brazil
    • Latinos/Chicanos in the U.S.

    Please submit abstracts of 200—300 words by January 1, 2011 to Lindsay Michie Eades(eades.l@lynchburg.edu) and Eunice Rojas (rojas.e@lynchburg.edu). Contributors will be notified of acceptance by February 1, 2011. Completed essays of 6000-9000 words will be due by August 1, 2011.

    cfp categories: african-americancultural_studies_and_historical_approachesethnicity_and_national_identityinterdisciplinaryjournals_and_collections_of_essayspopular_culturetwentieth_century_and_beyond 39092Fashion and Middle Brow Modernism (12/15/10; 4/20- 4/23/2011Popular Culture Association/ American Culture Association Annual National Conferencelwalker@usm.maine.edu1288900181gender_studies_and_sexualityinterdisciplinarymodernist studiespopular_culturetwentieth_century_and_beyondfull name / name of organization: Popular Culture Association/ American Culture Association Annual National Conferencecontact email: lwalker@usm.maine.edu

    Fashion and Middlebrow Modernism
    National Conference of the Popular & American Culture Association

    April 20-23, 2011 • San Antonio, TX
    San Antonio Marriott Rivercenter

    The Popular Culture Association and American Culture Association will hold its National Convention at San Antonio, Texas, on April 20-23, 2011. Proposals are now being accepted for a panel on Fashion and Middlebrow Modernism.
    The conception of modernism has been expanded to include literature and culture outside high modernism and the avante garde. This panel will explore the intersections of highbrow modernism with middlebrow modernism, as well as the development of middlebrow modernism outside of the avant-garde, through the discourses of fashion and beauty culture. Papers on a range of genres and topics are welcome, including
    • Fiction, autobiography and biography
    • Literary production and reputation
    • Art and art collecting
    • Film
    • High fashion
    • Ready to wear
    • Fashion cycles
    • Fashion markets
    • Designer furniture and décor
    • Advertising
    • Popular Culture
    • Beauty culture
    • Children and fashion
    • Pets and fashion
    • Gender and sexuality and fashion
    • Class, race, age and fashion
    Abstracts of 300-400 words may be submitted to Professor Lisa Walker (lwalker@usm.maine.edu) by December 15, 2010. Please include a working title and a brief biography of 100 words with your submission. Email submissions are preferred. Registration and conference information is available at http://www.pcaaca.org/conference/national.php.

    cfp categories: gender_studies_and_sexualityinterdisciplinarymodernist studiespopular_culturetwentieth_century_and_beyond 39093Science Fiction and Ageing Panel at the 'New Cultures of Ageing Conference': 8-9 April 2011; Brunel University.Joseph Norman - Brunel Universityjoseph.norman@brunel.ac.uk1288902523cultural_studies_and_historical_approacheshumanities_computing_and_the_internetinterdisciplinarypopular_culturescience_and_culturetheorytwentieth_century_and_beyondfull name / name of organization: Joseph Norman - Brunel Universitycontact email: joseph.norman@brunel.ac.uk

    On the 8-9 April 2011, Brunel University will hold the 'New Cultures of Ageing Conference', an interdisciplinary event focusing on representations of ageing in the Humanities and Social Sciences. Keynote speakers include Fay Weldon and Will Self. For more information about the conference, please visit:
    http://www.brunel.ac.uk/about/acad/sa/artsub/english/engresearch/fcmap/c...

    Call for Papers:
    The Science Fiction and Ageing panel at the 'New Cultures of Ageing' conference invites submissions that examine the theme of ageing in works of Science, Fantasy, Dystopian and Speculative Fiction. For many years, authors have sought to explore, challenge perceptions of and predict the future of the human ageing process; Science Fiction authors in particular, have engaged with this subject, exploring themes such as:
    • Immortality;
    • Artificial (and natural) life-extension;
    • Death and the afterlife;
    • The embellished and adapted body.
    The panel already includes a paper on portrayals of ageing in the 'Culture series' by acclaimed Science Fiction writer, Iain M. Banks, but many other texts from the genre offer possibilities; for example:

    • Greybeard by Brian Alldis (Faber and Faber, 1964);
    • 334 by Thomas Disch (MacGibbon and Kae, 1972);
    • Holy Fire by Bruce Sterling (Bantam, 1996);
    • Rollback by Robert J. Sawyer (Tor, 2007);
    • Chalcot Crescent by Fay Weldon (Corvus, 2009);
    • Riser by Rebecca E. Smith (Barnes and Noble, 2010);

    Papers may wish to consider the above themes, novels and authors, but are by no means restricted by them.
    All papers accepted for the panel will be published in a post-conference collection entitled 'Fiction and Ageing', which will probably be published online in the journal EnterText.

    For consideration, please submit expressions of interest and a 200 word abstract to joseph.norman@brunel.ac.uk no later than DECEMBER 1st 2010.

    cfp categories: cultural_studies_and_historical_approacheshumanities_computing_and_the_internetinterdisciplinarypopular_culturescience_and_culturetheorytwentieth_century_and_beyond 39094M@P CFP: "Mater(ia) familias: Family Matters" April 1-2, 2011, University of PennsylvaniaMedievalists@Pennpennmedieval@gmail.com1288909111cultural_studies_and_historical_approachesgender_studies_and_sexualityinterdisciplinarymedievalfull name / name of organization: Medievalists@Penncontact email: pennmedieval@gmail.com

    Keynote speaker: Ann Marie Rasmussen, Duke University

    From the nuclear to the royal to the holy, families fill the Middle Ages. As a dominant structuring principle of society, the concept of the family knits together the prevalent social, political and economic relations attending the formation and development of the medieval subject. As an ideological construct, the family motif pervades all spheres of cultural expression, from theological and philosophical debates to literary creations, visual productions and musical
    compositions. As a taxonomizing unit, the notion of family organizes our understanding of language, of material texts and of literary categories. This year's theme asks us to probe and complicate the questions of gender, structure and power raised by the idea of the family in order to illuminate the complex discursive relations at the heart of medieval society.

    Our conference invites submissions concerning one or more formulations of the idea of family. Proposals might look at actual families,whether functional or dysfunctional, real or supernatural, or seek to theorize more abstract concepts of family in relation to linguistic groups, manuscripts and textual transmission. As per our group's mission, we welcome a plurality of perspectives from across all fields of study in recognition of the profound interdisciplinarity of our common object of inquiry: the Middle Ages.

    Topics might include, but are not limited to, the following:

    genealogies
    text and manuscript families
    families of believers
    divine families, the Trinity
    monastic orders
    gender roles
    supernatural/monstrous families
    genre and canon formation
    arranged marriages
    marriage as economic transaction
    kinship structures
    nontraditional/non-nuclear families
    sibling rivalry
    conduct manuals, didactic texts
    wills, legacies, inheritances, posterity
    language families
    ruptures, estrangement, long distance relationships
    incest
    polygamy
    childbearing and childrearing
    dynasties

    Please send 300-word abstracts to pennmedieval@gmail.com by January 15, 2011

    cfp categories: cultural_studies_and_historical_approachesgender_studies_and_sexualityinterdisciplinarymedieval 39095The Power of the Humanities (MCLLM), April 1-2, 2011Midwestern Conference on Literature, Language, and Mediamcllm@niu.edu1288912991african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsgraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryinternational_conferencesjournals_and_collections_of_essaysmedievalmodernist studiespoetrypopular_culturepostcolonialprofessional_topicsreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorianfull name / name of organization: Midwestern Conference on Literature, Language, and Mediacontact email: mcllm@niu.edu

    The 19th annual
    Midwestern Conference on Literature, Language, and Media (MCLLM)
    will be held April 1-2, 2011
    at Northern Illinois University in DeKalb, Illinois.
    Keynote speaker: Dr. Emily Auerbach, University of Wisconsin-Madison, author of Maestros, Dilettantes, and Philistines (1989) and Searching for Jane Austen (2004); Director of the UW Odyssey Project; and Project Director of the "Courage to Write" radio series.
    This year's theme is The Power of the Humanities. Inspired by Dr. Auerbach's keynote address and her work across the humanities, the organizers encourage research that examines the influences of language and literature that have significantly altered those disciplines and people's lives.

    We invite proposals for fifteen minute papers from scholars at all stages of their career. Topics related to this year's theme may include, but are not limited to:
    - the construction of gender and ethnicity,
    - writing across the curriculum,
    - how individual authors or works influenced the discipline and/or canon,
    - the power of literature to change lives,
    - how people use language to exercise power,
    - writing literature to exercise power,
    - reading to exercise power,
    - literature and its influence on people from underprivileged areas,
    - efforts in the humanities to enact social and political change, and
    - the effects of college programs in any discipline designed to encourage the success of students who are underprivileged.

    MCLLM also welcomes papers on all areas of literature, language, and media studies.

    Individual or panel (three to four people) proposals are welcome.

    Proposals (no more than 500 words) by January 20, 2011, (e-mail submissions only, please) to:
    mcllm@niu.edu

    cfp categories: african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsgraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryinternational_conferencesjournals_and_collections_of_essaysmedievalmodernist studiespoetrypopular_culturepostcolonialprofessional_topicsreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorian 39096Colloquium Series: New Research in Foucault Studies (12/1/10)The Foucault Societyfoucaultsocietyorg@gmail.com1288936987cultural_studies_and_historical_approacheseighteenth_centuryethnicity_and_national_identitygender_studies_and_sexualitygeneral_announcementsinterdisciplinarypostcolonialreligionscience_and_culturetheorytwentieth_century_and_beyondvictorianfull name / name of organization: The Foucault Societycontact email: foucaultsocietyorg@gmail.com

    The Foucault Society is pleased to announce a new colloquium series, which will begin in January 2011 and meet monthly in New York City. As a forum for new research and works-in-progress, this series will provide an opportunity for both junior and senior scholars to share new work with a friendly and supportive audience of colleagues.

    We invite paper proposals on any aspect of Foucault studies. Papers may offer close readings of Foucault's texts; analyze social, cultural or political phenomena in the context of Foucaultian critique; or situate Foucault's work in terms of related thinkers or areas of critical theory. Diverse critical, historical and empirical approaches are welcome, as are critiques of Foucault and comparative readings.

    Papers should be approximately 30 minutes reading time.

    Graduate students, recent Ph.D.s, new faculty, and independent scholars are especially encouraged to apply. Presenters may come from any field in the humanities or social sciences.

    Please send 500-word abstract and c.v. to the Foucault Society's Executive Committee at foucaultsocietyorg@gmail.com. Inquiries are welcome.

    Deadline for Spring 2011 presentations: December 1, 2010. Papers received after that date will be considered until the schedule is full.

    Deadline for Fall 2011 presentations: May 30, 2011.

    For more information, we invite you to visit our newly updated website: www.foucaultsociety.org.

    Join our Facebook page: http://www.facebook.com/group.php?gid=12929420844

    ****
    About the Foucault Society:
    The Foucault Society is an independent, non-profit educational organization, based in New York City. We host reading groups, lectures, and conferences dedicated to critical study of the work of Michel Foucault (1926-1984) within a contemporary context.

    cfp categories: cultural_studies_and_historical_approacheseighteenth_centuryethnicity_and_national_identitygender_studies_and_sexualitygeneral_announcementsinterdisciplinarypostcolonialreligionscience_and_culturetheorytwentieth_century_and_beyondvictorian 39097Deadline for proposals:25 February 2011PAMUKKALE UNIVERSITY 2nd International BAKEAbakea.pau@gmail.com, macelikel@pau.edu.tr 1288949944african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identitygender_studies_and_sexualitygeneral_announcementsgraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryinternational_conferencesjournals_and_collections_of_essaysmedievalmodernist studiespoetrypopular_culturepostcolonialprofessional_topicsreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorianfull name / name of organization: PAMUKKALE UNIVERSITY 2nd International BAKEAcontact email: bakea.pau@gmail.com, macelikel@pau.edu.tr

    PAMUKKALE UNIVERSITY
    Denizli, Turkey
    2nd International
    BAKEA
    Symposium of Western Cultural and Literary Studies

    5-6-7 October 2011

    The BAKEA Symposium welcomes papers and panel proposals from the researchers in the fields of English, American, French and German Cultures and Literatures

    IDEOLOGY
    Literature, Medvedev argued, not only participates in the social process, it is in and of itself a special social entity. "Literature enters into the milieu of ideological activity as one of its autonomous branches, occupying a special place in it as a set of distinctively organized verbal productions with the structure of a kind specific and peculiar to such productions alone. This structure, as of any other ideological structure, refracts the generative process of socioeconomic existence, and does so in its own peculiar way…. In its content, literature reflects the ideological purview, i.e., other, unartistic (ethical, cognitive, etc.) ideological formations" (27-29).
    This conference solicits proposals for papers by researchers and scholars in the fields of English, American, French and German Cultures and Literatures that examine the role of ideology in literature and the relationship between ideology and literature to be presented at a 3-day- conference on October 5-6-7, 2011, Pamukkale University in Denizli, Turkey.
    The BAKEA Symposium welcomes papers and/or panel proposals that cover, though not limited to, one or more of the following topics:
    Ideology and discourse/narrative - Ideology and violence - Ideology and body - Ideology and space - Ideology and translation - Ideology and language - Ideology and education - Ideology and culture - Ideology and author - Ideology and art - Ideology and politics - Ideology and sex/gender - Ideology and representation of good/evil - Ideology and fantasy - Ideology and mythology - Ideology and race - Ideology and modernism/postmodernism - Ideology and colonialism/postcolonialism - Ideology and civilisation
    Deadline for proposals:
    25 February 2011

    Please send a 200-250 word-abstract with a short bio by
    25 February 2011 as Word-file attachment to one of the following addresses:

    bakea.pau@gmail.com, macelikel@pau.edu.tr
    Registration Fee:
    For lecturers 250 TL / € 125
    For Research Assistants and Postgraduate students 220 TL / € 110
    Deadline for registration is 17 June 2011
    The registration fee covers the symposium pack, three lunches and three dinners during the symposium including the Gala dinner, coffee, tea and refreshments, the sightseeing tour after the symposium and the symposium book of selected papers. The fee does not cover the accommodation expenses.

    Organising Committee
    Assoc. Prof. Dr. Ertuğrul İşler
    Assoc. Prof. Dr. Nurten Sarıca
    Assist. Prof. Dr. Meryem Ayan
    Assist. Prof. Dr. Şeyda İnceoğlu
    Assist. Prof. Dr. Mustafa Sarıca
    Assist. Prof. Dr. Mehmet Ali Çelikel
    Assist. Prof. Dr. Cumhur Yılmaz Madran
    Lecturer Nevin Usul
    Lecturer Ali Güven
    Re. Assist. Baysar Tanıyan
    Re. Assist. Selime Soyuçok
    Re. Assist. Reyhan Özer Tanıyan

    The accepted paper will be announced on 15 April 2011.

    cfp categories: african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identitygender_studies_and_sexualitygeneral_announcementsgraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryinternational_conferencesjournals_and_collections_of_essaysmedievalmodernist studiespoetrypopular_culturepostcolonialprofessional_topicsreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorian 39098[Akademeia]: A peer-reviewed multidisciplinary journal Akademeiainfo@akademeia.ca1288959687african-americanamericanclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identitygender_studies_and_sexualityhumanities_computing_and_the_internetinterdisciplinaryjournals_and_collections_of_essaysmodernist studiespostcolonialprofessional_topicsreligionscience_and_culturetheorytwentieth_century_and_beyondfull name / name of organization: Akademeiacontact email: info@akademeia.ca

    Akademeia is a multidisciplinary peer-reviewed journal. Akademeia will be publishing its inaugural issue in January 2011 and welcomes contributions from students, trainees and faculty members from both the sciences and liberal arts. Prospective authors should consult the most recent Guide For Authors, available on our website . All submissions (either in the form of research articles, hypotheses, canvas, or reviews) are subjected to double-blinded review by at least one student reviewer and one expert reviewer.

    www.akademeia.ca

    cfp categories: african-americanamericanclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identitygender_studies_and_sexualityhumanities_computing_and_the_internetinterdisciplinaryjournals_and_collections_of_essaysmodernist studiespostcolonialprofessional_topicsreligionscience_and_culturetheorytwentieth_century_and_beyond 39099INTERNATIONAL JOURNAL OF ADVANCED AERONAUTICAL ENGINEERING AND APPLIED RESEARCH i IJAAEARISERPhelpdesk@iserp.org1288968274general_announcementsgraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryinternational_conferencesscience_and_culturetheoryfull name / name of organization: ISERPcontact email: helpdesk@iserp.org

    Call for Papers - International Journal of Advanced Aeronautical Engineering and Applied Research - IJAAEAR

    Website: http://www.ijaaear.iserp.org

    Important Dates:

    Manuscript Submission: 15-11-2010
    Manuscript Review Feedback: 20-11-2010
    Manuscript Registration: 30-11-2010
    Manuscript Publication: 10-12-2010

    IJAAEAR welcomes research articles from scientists, Engineers and Research Scholars involved in Aeronautical Engineering and its related Aeronautical Engineering applications from all over the world to publish high quality and refereed papers.

    Papers for publication in the IJAAEAR are selected through rigorous peer review to ensure originality, timeliness, relevance, and readability.

    High-quality papers are solicited that will undergo the usual Double Blind Peer-Review (DBPR) procedure of the Journal for inclusion in the IJAAEAR Journal. Authors must upload their manuscripts in .doc or docx format. For more details please visit http://www.ijaaear.iserp.org

    The aim of IJAAEAR is to publish peer reviewed research and review articles in rapidly developing field of Aeronautical Engineering and all other related Aeronautical Engineering Technologies. IJAAEAR seeks clearly written survey and review articles from experts in the field, to promote insightful understanding of the state-of-the-art and application trends. IJAAEAR aims to cover the latest outstanding developments in the field of Aeronautical Engineering and all other related Aeronautical Engineering Technologies but not limited to the following branches,

    Topics Covered

    * Advances in Aeronautics and Astronautics
    * Aeroacoustics
    * Aeroelasticity and Control
    * Aeronautical billing computerized systems
    * Aeronautical invoicing system
    * Aeronautics and Astronautics
    * Aerospace Defense Systems
    * Aerospace Materials
    * Aerospace Propulsion Systems
    * Aerospace Structures
    * Affordable launch systems and developing countries
    * Air traffic control (ATC) billing computer systems
    * Air traffic control information technology
    * Aircraft design and computers
    * Aircraft, Helicopter and UAV Design
    * Aircraft, Spacecraft, Aeronautical and Astronautical Engineering Education
    * Airline reservations information systems
    * Airline/handling agents information systems
    * Airport operational database (AODB)
    * Applied Aerodynamics
    * Apron handling technology
    * Artificial intelligence uses in profiling
    * ATM/CNS
    * Aviation and computer simulation
    * Aviation data communications
    * Avionics Engineering
    * Biosecurity in the aviation industry
    * Business intelligence systems in aviation
    * Combustion Analysis
    * Combustion and Propulsion
    * Communication Systems and Technologies
    * Composite Structures
    * Computational Fluid Dynamics
    * Computerized ledger systems in aviation
    * Computerized security checking
    * Cooling Systems
    * Decision sciences and management information systems in aviation
    * Design and construction of space structures, materials
    * Design and construction of space systems, simulation and testing
    * Developments in global positioning, interoperability, new applications, vehicle control
    * Developments in new space communication techniques, higher frequencies and bandwidths
    * Dynamics/Control/Avionics
    * Earth observation projects
    * Economics of computerization of aviation
    * Energy from Space
    * Engines
    * Environment, aviation, and information technology
    * E-service and Web intelligence
    * E-ticketing information technology
    * Evolutionary role of computation in aviation
    * Flight and airport management and planning
    * Flight Dynamics and Control
    * Flight information display systems (FIDS)
    * Flight Performance
    * Flight Simulation
    * Flow Visualization
    * Fluids Mechanics and Aerodynamics
    * Fuel Injection
    * Fuzzy computation uses in aviation
    * Global navigation satellite system (GNSS)
    * Global positioning systems (GPS) in aviation
    * Guidance and Control
    * Heat Transfer and Burning
    * How non-space-faring nations can reap the benefits of space
    * Human factors considerations for aviation security technologies
    * Human-computer interaction in aviation industry
    * Incident management information systems
    * Intellectual property (IP)
    * International cooperation, especially among space-faring and developing countries
    * Knowledge management in aviation
    * Multidiciplinary design Optimization
    * Navigation
    * Near- Earth Space Physics
    * Network planning, slot allocation, and scheduling computer systems
    * Network simulators
    * New and novel instrumentation for various spacecraft functions
    * New remote sensing technologies and applications
    * Object-oriented technology in aviation applications
    * Project management (PM)
    * Property management and interactive voice response (IVR)
    * Radio frequency identification (RFID) applications and security in aviation
    * Resource planning and management systems
    * Satellite Attitude Control
    * Satellite delivery of meteorological forecast data for aviation (SADIS)
    * Satellite Technologies
    * Scientific applications, near Earth space, deep space, microgravity sciences
    * Security and management
    * Self-service kiosks (SSK) in airports
    * Sensors and Actuators
    * Simulation and modelling in aviation industry
    * Simulators and training in aviation industry
    * Simulators validation, verification, and testing
    * Small satellites, micro, nano and pico satellites, cubesat developments
    * Smart Structures
    * Software challenges in aviation systems
    * Space law, space medicine, and social, educational and other benefits of space
    * Space robotics
    * Space technologies
    * Space weather
    * Spacecraft Propulsion
    * Staff management displays systems
    * Structural Analysis
    * Structural Dynamics and Control
    * Structural Testing
    * Structures and Materials
    * Turbines
    * Unmanned Air Vehicle
    * Unmanned vehicle systems (UAS) and computer systems
    * Unsteady Aerodynamics
    * Wind Tunnel Testing

    Kind Regards,
    Editor in Chief

    cfp categories: general_announcementsgraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryinternational_conferencesscience_and_culturetheory 39100Update: 2011 Conference on Modernity, Critique, and HumanismCalifornia State University, Los Angelesbroy@calstatela.edu1288974043gender_studies_and_sexualitygeneral_announcementsinterdisciplinarypostcolonialtwentieth_century_and_beyondfull name / name of organization: California State University, Los Angelescontact email: broy@calstatela.edu

    FEATURED SPEAKERS:
    Marshall Berman, City University of New York
    Jörn Rüsen, University of Essen, Germany
    Stephen Shepherd, Loyola Marymount University
    Frederik Tygstrup, University of Copenhagen, Denmark

    CALL FOR PAPERS
    This conference is the result of a close collaboration of faculty from Cal State L.A. with colleagues representing the Universidad de Guadalajara at Los Angeles, the Universidad Michoacana (México), the Universidad Autónoma Metropolitana-Cuajimalpa (México), CONACyT (Consejo Nacional de Tecnología y Ciencia), and the University of Copenhagen (Denmark). The aim of the conference is to present a forum for the discussion of ways in which modernity, critique, and humanism can be imagined, reasoned, and practiced in a world that has become increasingly interdependent. The conference organizers welcome debates on critical theory and modernity, including challenges to the very notion of their singular condition or possibility. The debates and scope of dialogue are thus open to the contemplation of synchronous but dissimilar modernities, to the critique of new forms of global communication, and to the diverse challenges to all aspects of University curricula, modern or emergent. The conference organizers also wish to reach beyond the limits of current and established debates, encouraging an interdisciplinary dialogue to consider and reflect on the experiences and theoretical models that have been recorded in print or other formats by scholars, artists, and writers with innovative representations of global modernities. The conference will critically examine how the meanings of modernity, critique, and humanism are interconnected. Transdisciplinarity is thus highly encouraged. We invite papers from a diverse range of disciplines of the humanities and the social sciences.

    Suggested areas of critical examination include (a) practices of interaction in civic, communitarian, national, and global communication; (b) pedagogical forms of instruction that are emergent and innovative in the fields of the humanities and the social sciences in modern Universities across the world; (c) challenges to humanism and the humanities by current research and world historical changes; (d) theoretical innovations in the fields of literature and the arts, criticism, social theory, politics, and philosophical and humanist thought. More specifically, the organizers of the 2011 Conference on Modernity, Critique, and Humanism invite papers on the following topics:

    I. HUMANISM AND THE HUMANITIES
    • The problematics of humanism, cultural traditions, and historical change.
    • Humanism or plural humanisms?
    • From the critique of humanism to post-humanism.
    • The meaning of humanism from ancient to modern civilizations.
    • The ethics of humanism and critique in non-Western world cultures.
    • Modernity, critique, humanism, and religion.

    II. MODERNITY, CRITIQUE, HUMANISM, AND SOCIAL THEORY
    • Contemporary debates about modernity in social theory.
    • Globalization and the challenges for critical theory.
    • Postcolonialism, humanism, and social theory.
    • Reconsidering urban space in social theory.
    • Humanism and institutions: toward a theory of responsibility.
    • Is there a humanist-turn in social theory?

    III. EXPERIENCES AND RESEARCH IN A GLOBAL MODERNITY
    • Migrant labor and the law: World workers with no legal protection.
    • Human life in the world's megacities.
    • Intersocial communication in the Electronic Age.
    • The question of humanism and ethics in a global context: case studies.
    • Global border conflicts.
    • Humanism, the arts, and the corporate culture industry.
    • The rise of megacities and the decline of the nation.
    • Humanism, critique, and modernity in relation to global ecosystems.

    IV. THE MODERN WORLD: QUESTIONS AND CHALLENGES
    • Humanism, critique, and the modern family structure.
    • Humanism and gerontology: aging and living through tradition and change.
    • Human values in societies facing political anarchy and violence.
    • Humanism and technology: toward a critique of understanding.
    • The meaning and function of humanism and modern art in world megacities.

    The deadline for a one-page abstract of conference papers is December 12, 2010. The submitted abstracts will be peer-reviewed, and their acceptance or rejection will be communicated by e-mail on or before December 15. If you live in Mexico, send your abstract as an electronic attachment to Dr. Oliver Kozlarek, okozlarek@yahoo.com; if in the United States or abroad, send to rcantu@calstatela.edu or mail to the following addresses:

    Dr. Roberto Cantú
    Professor of Chicano Studies and English
    California State University, Los Angeles
    5151 State University Drive
    Los Angeles, CA 90032
    USA

    cfp categories: gender_studies_and_sexualitygeneral_announcementsinterdisciplinarypostcolonialtwentieth_century_and_beyond 39101 "Short-Lived Tactical Connections: Owning Our Best, Failed Efforts at Community Outreach "; 250-350 word abstracts due Jan. 6Dr. Laurie Cella (Shippensburg University); Dr. Jessica Restaino (Montclair University)Dr. Laurie Cella - ljcella@ship.edu; Dr. Jessica Restaino - restainoj@mail.montclair.edu1288980351general_announcementsjournals_and_collections_of_essaysrhetoric_and_compositionfull name / name of organization: Dr. Laurie Cella (Shippensburg University); Dr. Jessica Restaino (Montclair University)contact email: Dr. Laurie Cella - ljcella@ship.edu; Dr. Jessica Restaino - restainoj@mail.montclair.edu

    One of the most salient themes within current service-learning scholarship is the importance of sustainability; Ellen Cushman puts it best when she argues that thoughtless practitioners have a "hit it or quit it" attitude. Committed teachers and community members work hard to establish strong ties between the university and the community; some scholars have even developed long standing, community-based writing centers that serve as models for the country (Utah, Pittsburgh, 826 Valencia).

    But these strong ties are pretty hard to come by. The very legitimate interruptions of time, resources, and, as Tom Deans has argued, the inherent contradictions between university and community writing genres and motives, always stand to intervene even when all involved have the best of intentions. What happens when a teacher moves into a new area and has to start making connections that first semester? Or when, even with a shared desire for sustainability, a year goes by between phone calls? Or perhaps, as Eli Goldblatt has demonstrated, when shifting needs and competing resources routinely reconfigure and redefine community ties? What about those very enthusiastic students who become markedly less available after semester grades are in and they feel the pull of alternative work, family, and academic responsibilities? Do we need to build ties that will last for years in order to do productive work with our students and community partners? How do we draw the boundary lines that define our community work as either a "success" or a "failure"? Must these lines even be drawn at all?

    In her recent book, Tactics of Hope, Paula Mathieu argues that these moments can be generative precisely because they are not strategic, or part of the colonizing efforts of the university. Instead, Mathieu posits that tactical approaches to community partnerships, strategies that "foreground the temporal and spatial challenges that street-based projects always face" best foster critical inquiry (17). Such partnerships allow for moments of surprise, serendipity, and unforeseen joy: what was planned may not happen at all, but something new and more invigorating might grow in its place. Mathieu makes the case that short-lived collaborations are, in fact, potentially part of the nature of the street and not always the result of a "hit it and quit it" attitude. Accordingly, Mathieu's work extends Derek Owen's definition of sustainability: "meeting today's needs without jeopardizing the well-being of future generations" (1). The challenge here is to continuously rethink sustainability in ways that resist disconnection from practitioners on the ground.

    For this call, we'd like to hear how teachers and community members face the twinned pull toward stability and spontaneity, between the kind of ties they want to make, and the ties they do make. While we all pursue community writing work with the best of intentions, we are interested in essays that explore efforts that help us rethink the meaning of "sustainability" and, perhaps more broadly, "success." These efforts, when considered through Mathieu's alternate lens, might offer moments of richness, threads of possibility, or lasting impact despite—or maybe even because of—their brief incandescence. What might we take away from our attempts at community writing work that ended quickly or without anticipated results? Are there instances where, when all seems to be failing, we—community partners, students, faculty—actually walk away with greater riches than if we had success we could measure by the book? What can we learn by looking at the tactics at work on the ground and in the streets right now?

    We are interested in essays that consider any of the following questions:
    If sustainability becomes a secondary, or lesser, goal, what are the characteristics of a successful, tactical project?
    What can and should be accomplished in a class, in a week, in a semester, or even a year?
    If resources are scarce, what strategies can be implemented to make useful and productive connections and collaborations?
    What happens when the project itself takes priority, and the future remains hazy?

    We hope this collection will contribute to conversations about the nature and definition of useful sustainability. We are interested in candid, critical work that explores the gaps between what should happen in our classrooms and community agencies, and what really happens. Acknowledging these moments will further a much-needed dialogue about the diverse and admittedly imperfect configurations service-learning and community-based writing projects can take. From this dialogue we anticipate a new sense of our possibilities and, hopefully, a rethinking of our short-lived collaborations.

    250-350 word abstracts due Jan. 6, 2011 to both ljcella@ship.edu and restainoj@montclair.edu

    cfp categories: general_announcementsjournals_and_collections_of_essaysrhetoric_and_composition 39102Special Journal Issue on European Cinema, 2011Film Studies at University College Corkeuropeancinema.ucc@gmail.com1288982638film_and_televisionjournals_and_collections_of_essaysfull name / name of organization: Film Studies at University College Corkcontact email: europeancinema.ucc@gmail.com

    Call for Papers
    Special Journal Issue on European Cinema, 2011

    The editors of Alphaville: Online Graduate Journal of Film and Media Studies seek additional articles for its in-progress inaugural issue to be published online in 2011.

    Alphaville is a new, fully peer-reviewed, biannual graduate journal that is committed to publishing fresh and original research in the fields of film and media studies. The Editorial Board is comprised of doctoral and post-doctoral researchers at University College Cork. It is the first of its kind in Ireland, and will be launched in early 2011.

    The International Advisory Board consists of some of the most renowned academics working in film studies today, and already includes:

    Ruth Barton (Trinity College Dublin)
    Stefano Baschiera (Queens University Belfast)
    Stella Bruzzi (Warwick)
    Maeve Connolly (Dun Laoghaire)
    Angela Dalle Vacche (Georgia IT)
    Derek Duncan (Bristol)
    Catherine Fowler (Otago)
    Mattias Frey (Kent)
    Kathrina Glitre (West of England)
    Mette Hjort (Lingnan)
    Ewa Mazierska (Central Lancashire)
    Toby Miller (California, Riverside)
    Barry Monahan (Cork)
    Diane Negra (University College Dublin)
    Dana Polan (Tisch, New York)
    Laura Rascaroli (Cork)
    John David Rhodes (Sussex)
    Michael Witt (Roehampton)
    Gwenda Young (Cork)

    The inaugural issue, which is currently in progress, stems thematically from a recent international graduate conference held at University College Cork in May 2010, 'Transnational, Transcultural, Transmedial: European Cinema Today'. The editors welcome abstracts for articles that fall under this rubric, and that would complement an already diverse collection. We are particularly interested in articles that explore the interrelationships of European cinema with regard to geography (transnational), culture (transcultural) and form (transmedial), either through close readings of specific texts or through broader considerations of practice in both past and contemporary European filmmaking and film theory.

    Areas include, but are not limited to:

    - Trans-/Inter-mediality in film
    - Experimental and avant-garde film
    - Documentary and non-fiction
    - National/transnational/international cinema
    - Cinema from Eastern Europe, the Mediterranean, Nordic countries, or small nations
    - European-American intersections, European-Asian intersections
    - Representations of ethnic/cultural diversity
    - Music, sound, and language in film

    Potential contributors are invited to submit an article abstract (300 words), along with a short bibliography and an up-to-date CV to the editors by 19 November 2010 and at the following email address: europeancinema.ucc@gmail.com

    The editors' decision will follow swiftly. Following acceptance, authors will be required to submit their articles by 24 January 2011. Completed articles submitted for peer-review should be 5000-6000 words in length and follow MLA style.

    Please contact the editors, Abigail Keating, Jill Murphy and Aidan Power, with any queries at the above email address.

    The journal website is currently under construction. All relevant details including style sheet and submission guidelines will be sent to authors directly via email.

    Film Studies at University College Cork: http://www.ucc.ie/en/filmstudies/

    cfp categories: film_and_televisionjournals_and_collections_of_essays 39103The Role and Practice of Artists in SocietyArt History Society of California State University Los Angelesahssymposium@gmail.com1288985779americancultural_studies_and_historical_approacheseighteenth_centurygraduate_conferencesinterdisciplinarymedievalpostcolonialrenaissancetwentieth_century_and_beyondfull name / name of organization: Art History Society of California State University Los Angelescontact email: ahssymposium@gmail.com

    The Art History Society of CSU Los Angeles is seeking submissions for "The Role and Practice of Artists in Society" Graduate Student Symposium which will be held on January 22, 2011. We welcome papers exploring the character, function, and status of artists within various civilizations from any period or epoch. Our goal is to investigate the position, training procedures, and general attitudes toward artists from a variety of civilizations and cultures in order to learn more about the different roles and practices of artists in diverse cultures.

    The symposium will feature a keynote address by Dr. Peter Lukehart who will speak on the topic "Why Academies?: The Organization and Training of Artists Across Time and Cultures." It is our intention to publish the symposium talks in a collection of essays.

    Please send a CV and an abstract of no more than 300 words for a twenty-minute paper by November 20, 2010 via e-mail to: ahssymposium@gmail.com

    cfp categories: americancultural_studies_and_historical_approacheseighteenth_centurygraduate_conferencesinterdisciplinarymedievalpostcolonialrenaissancetwentieth_century_and_beyond 39104ENCYCLOPEDIA OF THE ENVIRONMENT IN AMERICAN LITERATUREBrian Jonesenvirolit@gmail.com1288987836americanecocriticism_and_environmental_studiesfull name / name of organization: Brian Jonescontact email: envirolit@gmail.com

    The EEAL (forthcoming from McFarland Press, 2011) aims to provide the first ever sketch of a composite, diachronic and synoptic topography of the American environmental imagination, beginning with the first visitors to the 'New World', and ending with major contemporary authors.

    The EEAL is seeking contributors for remaining entries, either on overtly 'environmental' works or on major American authors, in poetry, fiction and literary non-fiction, whose work continues to exert a profound influence on America's sense of, and attitude toward, the environment.

    Details, including headword list and available entries, as well as guidelines and samples, can be found at http://enviroencyclopedia.blogspot.com/

    Contributors to the encyclopedia will receive a byline in the finished book, identifying them as the author of their entry; and in certain cases, authors contributing multiple entries will receive a complimentary copy of the encyclopedia upon its publication.

    Contributors will also enjoy the distinction of (a) providing critical pieces in the synoptic topography described above, and (b) offering many students and generalist readers their first introduction to the environmental dimension in a given work or author.

    Given the encyclopedia's target audience and introductory character, specialist knowledge is not required, just a firm grasp of the issues involved in a respective entry, and the ability (and will) to write lucid prose.

    The next deadline for submissions is February 1, 2011, and last, in early summer, 2011.

    If you would like to contribute to the encyclopedia, please reply to envirolit@gmail.com, indicating the specific entry or entries you are interested in (you are encouraged but by no means obliged to take on pairs of author/text entries), as well as where you are teaching/studying; and if a student, what and at what level you are studying.

    Please also include a CV highlighting any writing experience, and at least one writing sample (preferably of a similar nature).

    Brian Jones

    (Editor)

    cfp categories: americanecocriticism_and_environmental_studies 39105Red River Conference on World LiteratureNorth Dakota State UniversityCarlos.Hawley@ndsu.edu1288988676cultural_studies_and_historical_approachesinterdisciplinaryinternational_conferencespostcolonialfull name / name of organization: North Dakota State Universitycontact email: Carlos.Hawley@ndsu.edu

    CALL FOR PAPERS

    THE FOURTEENTH ANNUAL
    RED RIVER CONFERENCE ON WORLD LITERATURE

    APRIL 8 – 10, 2011
    NORTH DAKOTA STATE UNIVERSITY
    FARGO, NORTH DAKOTA

    Constructing Conflict: Adversaries, Antagonists,
    Enemies, and Opponents

    We invite papers and panel proposals on topics that explore the dynamics of identity and conflict as well as their many manifestations across classes, cultures, kingdoms, sects, societies, families, and nations.

    Possible topics may include, but are not limited to:

    Relationships of Conflict, Feuds, Rows, Duels, Affairs d'honneur, Creatures, Beasts, Gods and Demons, Monsters, Ogres, Trolls, Fiends, Spooks and Specters, Colonialism, Nationalism and Revolution, Post-colonial identity, Alien Opposition, World Wars and Wars of the Worlds, Heroes and Villains, Quests, Pilgrimages, Odysseys, and Paths of Hardship, ...

    While we are particularly interested in proposals that address the conference theme, papers and panels on all aspects of world literature will be considered.

    Individual presenters should submit a 250-word abstract, including name, complete mailing address, and e-mail address. Proposals for panels must include an abstract for each presenter, as well as names, addresses and e-mail addresses of each participant. Abstracts submitted as e-mail attachments in Word or Word Perfect are preferred but hard copies will also be accepted.

    Submissions must be received by December 6, 2010.

    Address all submissions or inquiries to:

    Carlos.Hawley@ndsu.edu

    Carlos Hawley, Coordinator
    Red River Conference on World Literature#2345
    PO Box 6050
    Department of Modern Languages
    North Dakota State University
    Fargo, ND 58105-6050

    cfp categories: cultural_studies_and_historical_approachesinterdisciplinaryinternational_conferencespostcolonial 39106PerspectivesVirginia Tech English Graduate Student Organizationvt.egso.2011conference@gmail.com1289056587african-americanamericancultural_studies_and_historical_approacheseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygraduate_conferenceshumanities_computing_and_the_internetmodernist studiespoetrypopular_culturepostcolonialrenaissancerhetoric_and_compositionromantictwentieth_century_and_beyondvictorianfull name / name of organization: Virginia Tech English Graduate Student Organizationcontact email: vt.egso.2011conference@gmail.com

    As graduate scholars, teaching assistants, and creative writers, we each bring unique perspectives to the contexts in which we write and the texts that we produce. Fortunately, the English discipline has shown an exceptional flexibility to incorporate our new perspectives while retaining a foothold on its firm foundations. Now, in this dynamic 21st Century climate, our discipline has shifted once again to include new genres, texts, and dialogues. This year, the Virginia Tech English Graduate Student Organization warmly invites you to share the fresh and innovative ways you represent our discipline. We welcome student selections concerning composition pedagogy, literary and rhetorical scholarship, and the artistic expressions of your perspective.

    cfp categories: african-americanamericancultural_studies_and_historical_approacheseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygraduate_conferenceshumanities_computing_and_the_internetmodernist studiespoetrypopular_culturepostcolonialrenaissancerhetoric_and_compositionromantictwentieth_century_and_beyondvictorian 39107[UPDATE] "Perspectives" February 26, 2011Virginia Tech English Graduate Student Organizationvt.egso.2011conference@gmail.com1289057921african-americanamericanchildrens_literaturecultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygraduate_conferenceshumanities_computing_and_the_internetmedievalmodernist studiespoetrypopular_culturepostcolonialreligionrenaissancerhetoric_and_compositionromantictwentieth_century_and_beyondvictorianfull name / name of organization: Virginia Tech English Graduate Student Organizationcontact email: vt.egso.2011conference@gmail.com

    Deadline for Abstracts: January 1, 2011
    Send to: vt.egso.2011conference@gmail.com

    As graduate scholars, teaching assistants, and creative writers, we each bring unique perspectives to the contexts in which we write and the texts that we produce. Fortunately, the English discipline has shown an exceptional flexibility to incorporate our new perspectives while retaining a foothold on its firm foundations. Now, in this dynamic 21st Century climate, our discipline has shifted once again to include new genres, texts, and dialogues. This year, the Virginia Tech English Graduate Student Organization warmly invites you to share the fresh and innovative ways you represent our discipline. We welcome student selections concerning composition pedagogy, literary and rhetorical scholarship, and the artistic expressions of your perspective.

    cfp categories: african-americanamericanchildrens_literaturecultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygraduate_conferenceshumanities_computing_and_the_internetmedievalmodernist studiespoetrypopular_culturepostcolonialreligionrenaissancerhetoric_and_compositionromantictwentieth_century_and_beyondvictorian 39108CFP - Gender and Sexualities Area 2011 Joint National & SWTX Regional Popular Culture/American Culture Association Conferencemjohnso9@wsu.edu1289065580gender_studies_and_sexualitypopular_culturefull name / name of organization: 2011 Joint National & SWTX Regional Popular Culture/American Culture Association Conferencecontact email: mjohnso9@wsu.edu

    Please join us for the 2011 Joint National PCA/ACA and SWTX Regional Conference in San Antonio, Texas! In keeping with this year's theme, the Gender and Sexuality Area will be looking for Alternative, Queer and LGBT Television, Film, Music and Media submissions. Submissions are desired from across the intellectual community to include independent scholars, high education faculty and secondary level educators; we are particularly pleased to encourage graduate student participation! This year's conference seeks to examine issues of visibility and the lenses through which LGBTQ identities are made available to audiences, listeners and readers of contemporary media within the US. And while we are interested in a variety of prospective topics, this year we are particularly interest in research about:

    Queer Cinema and Film
    Queer Music Videos
    Transgendered Telenarratives and Characters
    LGBTQ "Reality" Television

    Please send an abstract of 250 words, a working bibliography and a current CV to: mjohnso9@wsu.edu For more information please see www.swtxpca.org Thank you and hope to see you there!

    cfp categories: gender_studies_and_sexualitypopular_culture 39109Sound at Play: Music, Humor, and Games (deadline 12/15/10; conference 3/5/11)Columbia Music Scholarship ConferenceSoundatPlay2011@gmail.com1289066694cultural_studies_and_historical_approachesgeneral_announcementsgraduate_conferencesinterdisciplinarypopular_culturescience_and_culturetheatretheorytwentieth_century_and_beyondfull name / name of organization: Columbia Music Scholarship Conferencecontact email: SoundatPlay2011@gmail.com

    Call for Abstracts:
    SOUND AT PLAY: MUSIC, HUMOR, AND GAMES

    Columbia Music Scholarship Conference 2011

    The Columbia Music Scholarship Conference invites graduate students and recent Ph.D. recipients to submit abstracts to be selected for presentation at our ninth annual meeting on March 5, 2011 at Columbia University. We are soliciting proposals from scholars active in all fields related to the academic study of music, as well as other areas within the humanities, social sciences, education, or science and technology studies.

    We seek to seriously consider music as play. The many ways that composers, performers, intermediaries, and listeners play with music and sound allow us to examine music as a locus of humor, competition, rule, risk, pleasure, and amusement. Musical games teach us about social order early in our lives, yet musical humor is often profoundly subversive of social and cultural forms and structures. As various commercial sectors capitalize on the musically humorous, playful, and competitive, they also help produce new modes of sociability and musicality. How do humor and games influence musical activity and how does playful musicality produce the humorous? How have composers incorporated games and play into their works and how does musical humor affect cultural and economic value?

    Paper topics on music, humor, and games could encompass approaches focusing on a broad range of historical periods, cultures, societies, and various forms of musical activity, including composition, performance, distribution, consumption, and mechanical reproduction. CMSC aims to produce a fruitful methodological counterpoint by representing historical, biographical, sociological, textual, philosophical, and ethnographic approaches to the study of music and sound as play.

    Possible topics include, but are not limited to, the following: musical puns; timing, expectation and indeterminacy; "game pieces" and aleatoric composition; irony in music; music in computer/video games; music and sports; dance games; farce; comic opera; humor and games in musical improvisation; musical games as education; playful modes of musical sociality; cultural and economic value of the musically humorous; musical drinking games; musical play in childhood, adolescence, and among adults; subversion and competition in composition, performance, and consumption.

    Proposals/Abstracts: Abstracts of 250 words, including a title, should be submitted electronically by December 15, 2010 to: SoundatPlay2011@gmail.com. Please include your name and contact information in your email only, and attach the abstract as a Word, text, or .pdf file. The committee will select papers anonymously. All scholars who submit abstracts will be notified of the committee's decision by December 22, 2011.

    cfp categories: cultural_studies_and_historical_approachesgeneral_announcementsgraduate_conferencesinterdisciplinarypopular_culturescience_and_culturetheatretheorytwentieth_century_and_beyond 39110UpStage: A Journal of Turn-of-the-Century TheatreSouthern Illinois University Edwardsville; St. Mary's University Collegehgurfin@siue.edu, paullm@smuc.ac.uk1289090234americancultural_studies_and_historical_approachesethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualityinterdisciplinaryjournals_and_collections_of_essaysmodernist studiespopular_culturepostcolonialtheatretheorytwentieth_century_and_beyondvictorianfull name / name of organization: Southern Illinois University Edwardsville; St. Mary's University Collegecontact email: hgurfin@siue.edu, paullm@smuc.ac.uk

    UPSTAGE, a peer-reviewed online publication dedicated to research in turn-of-the-century dramatic literature, theatre, and theatrical culture, seeks submissions for its second issue scheduled for the spring or summer of 2011. This is a development of the pages published under this name as part of THE OSCHOLARS, and will henceforth be an independently edited journal in the oscholars group published at www.oscholars.com, as part of our expanding coverage of the different cultural manifestations of the fin de siècle.

    Topics may include, but are not limited to, the work of Shaw, Schnitzler, Ibsen, Chekhov, Strindberg, von Hofmannsthal, and their contemporaries in Western and Eastern Europe and beyond.

    UPSTAGE welcomes a variety of theoretical and critical methodologies.

    We are interested in receiving:

    Scholarly articles of approximately 3000 words
    Book-reviews of approximately 500 words
    Reports on work in progress (book manuscripts, Master's theses, and doctoral dissertations) (approximately 500-1000 words)
    Reviews of contemporary productions of turn-of-the-century plays (or plays about the turn of the nineteenth century) and announcements of future productions (approximately 500 words)

    The publication is international in scope. Although we will publish in English initially, we hope to include publications in other languages in the future.

    By February 15, 2011, please e-mail your submissions, as MS Word attachments only, to both

    Dr. Helena Gurfinkel, Department of English Language and Literature, Southern Illinois University Edwardsville, Edwardsville, IL, USA at hgurfin@siue.edu

    and

    Dr. Michelle C. Paull, Drama Programme, St. Mary's University College, Strawberry Hill, Twickenham, TW1, 4SX, England, at paullm@smuc.ac.uk

    Submissions should conform to the latest version of the MLA style. In order to undergo masked peer-review, scholarly articles must be submitted in the following way: the author's contact information and brief bio should appear in the body of the e-mail, while the Word attachment should contain no identifying information.

    cfp categories: americancultural_studies_and_historical_approachesethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualityinterdisciplinaryjournals_and_collections_of_essaysmodernist studiespopular_culturepostcolonialtheatretheorytwentieth_century_and_beyondvictorian 391111st global Conference: Queer Sexualities 13-15 May 2011 Warsaw, PolandInter-disciplinary.netmdegorska@gmail.com1289112577african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsgraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryinternational_conferencesjournals_and_collections_of_essaysmedievalmodernist studiespoetrypopular_culturepostcolonialprofessional_topicsreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorianfull name / name of organization: Inter-disciplinary.netcontact email: mdegorska@gmail.com

    20 years since the reclamation of the word 'queer' by the LGBTQ community this conference would like to take a closer look at broad themes of queer sexualities through time and space, non-normative sexual constructions and queer sexual identities from a diverse range of perspectives by scholars working in various academic disciplines. Yet our meaning of the word queer is not limited to the non-mainstream sexuality as we opt for inclusion of 'unusual' heterosexual practices into the 'queer domain' in order not to discriminate but understand, include and accept.

    Papers, reports, work-in-progress and workshops are invited on issues related to the following themes:

    * the role of historical forces in shaping queer sexuality(ies)
    * historiography of queer sexualities
    * the politics of queer sexualities
    * queertopias and the politics of gender
    * queer identities/sexualities in literature and art
    * queer sexualities and the body – literary and non-literary representations and resistances of non-normative corporeality
    * beyond queer sex and sexuality
    * queerotica vs. queerporn
    * queer sexualities and performativity
    * queer sexualities and age
    * queer sexualities and theory (queer theory, straight queer theory, sexuality studies, disability studies, feminist perspective, fat studies etc;)

    The Steering Group particularly welcomes the submission of pre-formed panel proposals. Papers will also be considered on any related theme. 300 word abstracts should be submitted by Friday 26th November 2010. If an abstract is accepted for the conference, a full draft paper should be submitted by Friday 1st April 2011.

    300 word abstracts should be submitted simultaneously to both Organising Chairs; abstracts may be in Word, WordPerfect, or RTF formats with the following information and in this order:

    a) author(s), b) affiliation, c) email address, d) title of abstract, e) body of abstract.
    E-mails should be entitled: QS1 Abstract Submission.

    Please use plain text (Times Roman 12) and abstain from using footnotes and any special formatting, characters or emphasis (such as bold, italics or underline). We acknowledge receipt and answer to all paper proposals submitted. If you do not receive a reply from us in a week you should assume we did not receive your proposal; it might be lost in cyberspace! We suggest, then, to look for an alternative electronic route or resend.

    Organising Chairs

    Malwina Degórska (Conference Leader)
    English Department
    University of Szczecin
    Szczecin, Poland
    E-mail: mdegorska@gmail.com

    Barbara Braid
    English Department,
    University of Szczecin,
    Szczecin, Poland
    E-mail: barbara.braid@gmail.com

    Rob Fisher
    Network Founder and Network Leader,
    Inter-Disciplinary.Net, Oxfordshire, United Kingdom.
    E-mail: qs@inter-disciplinary.net

    http://www.inter-disciplinary.net/at-the-interface/gender-and-sexuality/...

    The conference is part of the At the Interface programme of research projects. It aims to bring together people from different areas and interests to share ideas and explore various discussions which are innovative and exciting. All papers accepted for and presented at the conference will be eligible for publication in an ISBN eBook. Selected papers may be developed for publication in a themed hard copy volume(s).

    cfp categories: african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsgraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryinternational_conferencesjournals_and_collections_of_essaysmedievalmodernist studiespoetrypopular_culturepostcolonialprofessional_topicsreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorian 39112Historiography & Antiquarinism Conference, 12-14 August 2011University of Sydneyantiqua2011@gmail.com1289117978classical_studiescultural_studies_and_historical_approachesinterdisciplinaryinternational_conferencesmedievalrenaissancefull name / name of organization: University of Sydneycontact email: antiqua2011@gmail.com

    Historiography & Antiquarianism Conference, Sydney (12-14 August 2011) Information & CFP

    HISTORIOGRAPHY AND ANTIQUARIANISM (sponsored by CCANESA) 12-14 August 2011

    University of Sydney, Australia

    CFP: Title and a 150 word abstract due 15 January 2011

    This conference aims to expand a discussion on approaches to the past from Greco-Roman antiquity to the 17th century, and to assemble scholars interested in the relationship between history and antiquarianism in the ancient and pre-modern worlds. While antiquarian studies have expanded significantly in early modernist circles in the last 30 years, earlier centuries of antiquarianism (up to the 16th century) are only now beginning to attract interest. Was Arnaldo Momigliano right in 1950 that historians write narratives and solve problems, while antiquaries build systems and collect material remains? What has changed in our view of historiography and antiquarianism? Must we reconsider the disciplinary value of antiquarian methods? One historian has even recently argued: 'in the twentieth century antiquarianism conquered history.' The hope at this conference is to cross the boundaries between ancient and early modern historians and to provide new ideas for the study of culture in both fields.

    For further information see http://classics.org.au/haconference/

    email: antiqua2011@gmail.com

    cfp categories: classical_studiescultural_studies_and_historical_approachesinterdisciplinaryinternational_conferencesmedievalrenaissance 39113International Conference on Commonwealth Literature, December, IndiaIndian Society for Commonwealth Studies. http://www.commonwealthstudies.orgrkdhawan@gmail.com1289121907african-americangender_studies_and_sexualityinterdisciplinaryinternational_conferencesmodernist studiespostcolonialfull name / name of organization: Indian Society for Commonwealth Studies. http://www.commonwealthstudies.orgcontact email: rkdhawan@gmail.com

    http://www.commonwealthstudies.org

    Theme: New Literatures: Re-Forming Modern Sensibility

    Anti-colonial resistances have taken many forms, used a wide variety of methods to create new and alternative identities. The New Literatures have foregrounded the processes of re-locating the 'authorized' versions of histories and identities. The International Conference focuses on the diversity of the New Literatures in an attempt to critique matters of culture, ideology, nationality, ethnicity, hybridity, subjectivity, language, class and gender. It aims at exploring the subversive strategies adopted by the writers in their literary works in grappling with deep structures of meaning, value systems, and beliefs vis-à-vis the colonial package. It also seeks to examine the plethora of ideological issues included in the sub-themes, making them culture-specific and nation-specific. It highlights the active role played by the intellectuals and writers in the literary field without (emb)racing 'depressingly difficult' theory and/or jargon.

    As the conference is interdisciplinary and comparative in its import, papers are welcome from sister disciplines/ departments/ languages on themes having a close bearing on the main theme. The suggested sub-themes are
    ---
    (a) Multiculturalism in Canada, Australia, New Zealand and India
    (b) Francophone Literature
    (c) Women's Writing
    (d) Adivasi and Aboriginal Writings
    (e) Protest in African & African-American Literatures
    (f) Literatures of the Indian Subcontinent
    (g) Translation of Regional Literatures
    (h) Postmodernism and Postcoloniality in literary texts.
    ---
    The list of the themes is only illustrative, not exhaustive. Participants therefore can write papers on any theme of their choice, relating it to the broad theme.

    cfp categories: african-americangender_studies_and_sexualityinterdisciplinaryinternational_conferencesmodernist studiespostcolonial 39114Prosopopoeia, Petrification, and the Political (ACLA 2011 - Vancouver)David Kelmandkelman@fullerton.edu1289147124african-americanamericanclassical_studiescultural_studies_and_historical_approachesethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsinterdisciplinarymodernist studiespoetrypopular_culturepostcolonialreligionromanticscience_and_culturetheorytwentieth_century_and_beyondfull name / name of organization: David Kelmancontact email: dkelman@fullerton.edu

    This seminar proposes to examine the conjunction of the political and the inorganic, via the function of "putting a face on" the force of the political. For Walter Benjamin, history is "a petrified, primordial landscape" that is "expressed in a face — or rather in a death's head." His observation suggests that history imposes an inorganic mask upon the organic evolution of difference, or decomposition. We encourage the exploration of how this prosopopoeiac function may cast in ruins the struggle of politics inherent in any social history. In papers that address the materiality of politics and political ideology in literature and/or performance, we aim to theorize the manner in which prosopopoeia gives a face to history or the human struggle in the polis. What is the relation between politics and death? How does the political relate to terror (i.e., the state of being petrified)? What does it mean to enter into a state of petrification in the social realm? To what extent is the project of comparative literature implicated in a gesture that petrifies the shifting and even violent terms of difference or history, even as it valorizes the literary for "making the stone stony" (as Schklovsky described it)? We invite especially papers that explore these questions in terms of the politics of world literature/comparative literature.

    cfp categories: african-americanamericanclassical_studiescultural_studies_and_historical_approachesethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygeneral_announcementsinterdisciplinarymodernist studiespoetrypopular_culturepostcolonialreligionromanticscience_and_culturetheorytwentieth_century_and_beyond 39115Ethnic Studies Review seeks manuscript submissionsNational Association for Ethnic Studiescsanchez@ethnicstudies.org1289148503african-americancultural_studies_and_historical_approachesethnicity_and_national_identitypostcolonialfull name / name of organization: National Association for Ethnic Studiescontact email: csanchez@ethnicstudies.org

    The Ethnic Studies Review, the peer-reviewed journal of the National Association for Ethnic Studies (NAES), invites submissions for forthcoming issues. Ethnic Studies Review (ESR) is a multi-disciplinary international journal devoted to the study of ethnicity, ethnic groups and their cultures, and intergroup relations.

    Manuscripts received by December 15, 2010, will be considered for volume 33.2 to be published early 2011. Email submissions to csanchez@ethnicstudies.org

    Inquiries may be addressed to:
    Carleen D. Sanchez, Publications Chair
    University of Nebraska Lincoln
    919 Oldfather Hall
    Lincoln, NE 68588-0368
    Phone: 402-472-3925
    Email: csanchez@ethnicstudies.org
    Visit the website at www.ethnicstudies.org

    cfp categories: african-americancultural_studies_and_historical_approachesethnicity_and_national_identitypostcolonial 39116"Attending (to) the Party: Orientations and Simulacra of Public and Private Sites" March 24-25-26, 2011Concordia University English Literature Graduate Colloquium in Montrealattendingtheparty@gmail.com1289158712african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryjournals_and_collections_of_essaysmedievalmodernist studiespoetrypopular_culturepostcolonialreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorianfull name / name of organization: Concordia University English Literature Graduate Colloquium in Montrealcontact email: attendingtheparty@gmail.com

    Abstract: Call for Papers
    Concordia University English Literature Graduate Colloquium
    March 24-25-26, 2011

    Attending (to) the Party: Orientations and Simulacra of Public and Private Sites

    Everyone's alone — or so it seems to me.
    They make noises, and think they are talking to each other;
    They make faces, and think they understand each other.
    And I'm sure they don't. Is that a delusion?
    T.S. Eliot

    Throughout history, the notion of 'party' has served as a site for exploring prevailing liminalities: from ideological display to decorous intimacies to social multitudes, the party has served as a means of further repressing or extolling self within private and public domains, projecting identity formations of the other, or combating the enigmatic reflections of the public world. The dialectic of inclusion and exclusion—who is invited into a space, a sphere, an identity—has been used as a social tool and political wedge while at once advancing the bounds of restraint within prescribed modes of behaviour. Distinctions and delineations of such orientations in literature have never been straightforward: least of all today, where boundaries of private and public are more blurred than ever. How is a performance of belonging or of 'being private' received within a crowd, a gathering, a nation, or in a culture of social networking—do reflections or simulations of the 'party' ever stop? Is artifice encouraged by the heteroglossia, the absurdities of the carnivalesque, inversions of decorum? Individuals and collectives both encounter and anticipate fusions of the expected and unexpected in their search to negotiate lines between indulgences, reasonable parts/parties, or embodiments of culture. The notion of the party is not—and has never been—confined to the limits of social space, but rather is a transitory site of individual and group. Both textual and inter-textual notions of 'party' may include cocktail gatherings, reflections on singularity, revolutionary mobs, the construction of online identities, or a middling of 'inbetweeness'. It is a site of shared intersection—or collision. It is circuitousness, it is necessity; amid orientations of debauchery, protest, subsumption, or migration—singly or all at once.

    We invite papers focusing on the following themes:

    -Party of one: identity projections
    -Figuring decorum: alterations & presentations of normalcy
    -Simulacrum: masks, constructions & artifice
    -Sites of (in)visibility: notions of exclusion and inclusion
    -Block party: politics, affiliations, negotiating lines

    Concordia University's English Literature Graduate Colloquium examines the dynamics of 'party', prompting dialogues from all gathering points: from the political to the bacchanal, from the physical to the philosophical. We invite graduate students to contribute to this interdisciplinary English Literature colloquium by submitting a 200-250 word abstract to attendingtheparty@gmail.com by January 31st, 2011.

    For further information, and for colloquium updates, please visit our weblog: http://attendingtotheparty.blogspot.com/

    cfp categories: african-americanamericanbibliography_and_history_of_the_bookchildrens_literatureclassical_studiescultural_studies_and_historical_approachesecocriticism_and_environmental_studieseighteenth_centuryethnicity_and_national_identityfilm_and_televisiongender_studies_and_sexualitygraduate_conferenceshumanities_computing_and_the_internetinterdisciplinaryjournals_and_collections_of_essaysmedievalmodernist studiespoetrypopular_culturepostcolonialreligionrenaissancerhetoric_and_compositionromanticscience_and_culturetheatretheorytravel_writingtwentieth_century_and_beyondvictorian